KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_1047Help
Entry
Cphamn1_1047      CDS       T00709                                 

Definition
magnesium chelatase ATPase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cphamn1_1047
Enzymes [BR:cpb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cphamn1_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1131329..1133185
Genome map
AA seq 618 aa AA seqDB search
MIAFTDIVGMDLAKQAMMLLAVDPSLGGVVVPAAVGSGKSTLARAFSGIVSEDTPFVELP
LNVTEDRLIGGVDLEATLVQGKRVVQHGVLSKAHEGVLYVDSLSLLDSSAVSHVMDAMSR
GAVLVEREGLSEVHPAKFMLIGTYDPSDGDVRMGLLDRVGMIVPFTTQNDYRARKLIVNC
VLGKRDAEDTEDELKMLRGLIEAAQEQLPLVSMTKEQMQGLIQSAVSLGVEGNRADIFAI
KAALASAALAQRTDVDEDDLKLALKLVLVPRATQMPPQEEEVMDDMPPDEDMPPDSPESE
DQDAPDDNSDPDEEEEEEETPDMIEELMMEAIETELPDNIMNISLAAKRKSRSGSRGEAL
NNRRGRFVRSQEGEMRSGKVAIIPTLISAAPWQESRRAERKKKFGEIKTALIINKEDVRI
KKFRDKSGTLYIFMVDASGSMALNRMRQAKGAVSHLLQNAYVHRDQVSLISFRGKEAQLL
LPPSQSVDRAKRELDVLPTGGGTPLASALFLGLETAKQARTKGVSQIMFVVITDGRGNIS
LQSSYDPDAPKATKEEVQQEIEAISATIFAEGVASVIIDTQMNYLSRGEAPKLAEKLGGR
YFYLPNAKAEEIAMAALS
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatagcttttaccgatattgttggaatggatctggcaaagcaggcgatgatgctgctt
gccgttgatccttctcttggcggggtagtggttccggcggctgtcgggtccggcaagtcc
acacttgcaagggctttttccggtatagtttcggaagatacgccttttgtcgagttgcct
ttgaatgttacggaagaccggttgatcggcggcgtagatctcgaagcgacacttgttcag
ggtaagcgtgtcgttcagcacggcgtgctctccaaggctcacgaaggagtgctctacgta
gattctttgagtcttcttgacagctccgctgtttcccatgtcatggatgccatgtcgaga
ggagcggtgcttgttgaacgtgaaggcctcagtgaggtgcatccggcgaaatttatgttg
atcggaacctatgatccttccgatggggacgtccgtatgggacttcttgaccgggtaggc
atgattgttcctttcaccacccagaacgattacagggcacgtaagcttatcgtcaactgt
gtactcgggaaaagagacgctgaagacactgaagatgagctgaaaatgcttagagggctt
atcgaagcggctcaagagcagcttccgcttgtttccatgaccaaggagcagatgcaggga
ctgattcagtctgccgtcagtctcggggtagagggtaaccgtgccgatattttcgccatt
aaagccgctcttgcaagtgcagcccttgcgcagcgtaccgacgttgacgaggatgatctt
aaacttgctctcaagcttgtgctggttcccagagcgacgcagatgcctccgcaggaagag
gaggttatggacgatatgcctccggatgaagatatgcctccggatagtcctgaatctgaa
gatcaggacgcgcctgatgacaattccgatcctgatgaggaggaggaagaggaggaaact
ccggacatgatcgaggagctgatgatggaggccatagagactgagttaccggacaacatc
atgaacatttctctcgcggcaaaaagaaaaagcaggtccggaagccgtggagaagccctc
aacaatcgtcgtggccgctttgtccgttcccaggaaggtgagatgcgtagtggaaaggta
gcgattattccaacgctgatttcagcggcaccatggcaggagagccggagagcggaacga
aaaaagaagttcggcgaaattaaaactgccctgattatcaataaagaagatgtcaggatc
aagaaatttcgtgacaagtccggaaccctgtatatcttcatggtcgatgcatccggttcc
atggcattgaaccgcatgcgccaggcaaagggcgcggtctcgcatttgctgcagaatgcg
tatgttcatcgtgatcaggtttcactgatttctttcagaggaaaagaggctcagcttcta
ctgccgccgtcgcagagtgtggatcgagcaaagagagagcttgatgtgctgcctaccggc
ggaggaacgccgcttgcttctgctctttttcttggattggaaacggcaaaacaggcccgg
acaaaaggtgtttcacaaatcatgtttgttgtgattaccgatggtcgaggtaacatcagt
ctgcagtcctcgtatgatcccgatgcgccaaaagcgacaaaagaggaggtgcagcaggag
atcgaagccatttcagccaccatattcgcggagggcgtcgcttctgttattatcgacacc
cagatgaactacctttcacggggagaagcgccaaagcttgctgaaaaacttgggggacgg
tatttttatctgccgaacgccaaagccgaagagatcgcaatggcagctctgagttga

DBGET integrated database retrieval system