KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_1084Help
Entry
Cphamn1_1084      CDS       T00709                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cphamn1_1084
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphamn1_1084
  Lipid metabolism
   00071 Fatty acid degradation
    Cphamn1_1084
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cphamn1_1084
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cphamn1_1084
   00626 Naphthalene degradation
    Cphamn1_1084
Enzymes [BR:cpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cphamn1_1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1172611..1173639
Genome map
AA seq 342 aa AA seqDB search
MKAQVIERITDLSESSEPLRMVEMPVPEPAAGEVLLKVLTCGVCHTELDEIEGRTPPAFF
PIVPGHQVVGEVVAQGAGVSQPEIGSRVGVAWIYSACGKCELCLDGKENLCLEFRATGRD
AHGGYAEYMTVPVSSAYSLPDLFSDAEAAPLLCAGAVGYRSLKLLNLQNGQPAGLTGFGA
SAHLVLKLMRFLYPDSPVHVFARNLQEREFSLALGAVWAGDTTDSSPELLAGIIDTTPVW
LPVLSALENLRPSGRLVINAIRKEASDTDVLTQLDYAKHLWMEKEIKSVANVAAEDVRQF
LKIAASMHMKPEVQIYSFEEANRALIDIKQRRIRGAKVLQIA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcaggttattgaaaggattacagacttgtcagagagctctgaaccgctgagg
atggttgagatgccggttcctgagcctgctgctggtgaggtgctgctgaaggtgctgacc
tgcggggtttgtcatacggagctggatgagatagaagggagaaccccgcctgcttttttt
ccgatcgttccgggccatcaggttgtgggagaggttgtcgctcaaggagcaggggtaagc
caacccgaaatcgggagcagggtaggggtagcctggatatattccgcctgcgggaaatgt
gaactgtgcctcgacggtaaagagaatctgtgcctggagtttcgtgccaccggacgggac
gctcatggggggtatgcggaatatatgactgttcccgtttcttctgcctattcacttcct
gatctcttttccgatgctgaagccgcgcctcttctgtgtgcgggtgctgtcgggtatcgg
tcactgaagctgctgaatctgcaaaacggccagcctgcggggttgacaggtttcggggct
tcagcgcatcttgttttgaaattgatgcggtttctctaccctgattcgccggttcatgtt
tttgcccgaaacctgcaagagcgtgaattctcccttgctctcggagcagtctgggctgga
gatacaaccgattcatctccggaactccttgccggtatcatcgacaccacgccggtctgg
ctgcccgtcctgtccgcacttgagaatctcagaccatcaggccgtctggtcatcaatgcg
atccgcaaagaagcgtcggatacagatgtgcttacgcagctcgattatgcgaagcatctc
tggatggagaaggagatcaaaagcgtggccaacgttgccgctgaggatgtcaggcagttc
ctgaagattgctgcatccatgcacatgaagccggaagtgcagatctattcttttgaagag
gcgaacagagcccttattgacataaagcagcgccggatcaggggcgcgaaagtgcttcag
attgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system