KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_1149Help
Entry
Cphamn1_1149      CDS       T00709                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
cpb  Chlorobium phaeobacteroides BS1
Brite
Enzymes [BR:cpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Cphamn1_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1235518..1238592
Genome map
AA seq 1024 aa AA seqDB search
MKLIFKQQPYQTDATMAVVGCFEGQSKGFRKEVVGRETLDHGLFGTEVKVEEIFSNKKLE
ITEVDILKNVQALQKEQGLKTISKLDGLNFTTEMETGTGKTYVYTKTMYELNKHYGWNKF
IIMVPSVAIREGVHKSLEITADHFQEIYGKKIRFSIYNTQNKSNLINIKSFANTSNIEVL
IMNYQAFATTSQESRKIYQKLDTLQSERPIDIIKRARPILIIDEPQRMGIEEGKVFSGNK
PSKVVEAIYRNNEFNHLCTLLYSATHKKDFNKIYRLDAIDAYNQKLVKKISVKGIEVVGN
SGTNSYLFLDKIQISTSQFPVAYVELEVKQANGIQKKIRQIKEKDDLYVFSNELKQYKGF
VVKSINGLTNTVSFTNGITLSVGQTAGDVDEEHVRRIQIRETIKSHIEKERIMFQKGIKV
LSLFFIDEVVKYRDYSSPDQKGIYAKVFEDEYRQAISELSLFEPDYNDYLSKFTVEDIHK
GYFSVDKKGLFIDSKEKRGESGSDDVSAYDLIMKKKEILLDLKESTRFIFSHSALREGWD
NPNVFQICTLKHSQSEISKRQEIGRGLRICVNSKGERMDASVLDSDFFDVNKLTVVASES
YDSFAKALQNEIVESLSERPVTLTIEVLNNRVIHNEKGEKFVFDSQSSMDLIFDMKTKGY
LDANYHITEALITDVENKTYALPEKLQGFESCVAELMTGIYTTANFKAAENENANNINEA
ILKPNDNFAKKEFQDLWKKIKVKTVYEVDFESAELVDLCVKAIDTNLTVKKILINITSGE
QQDKIDEATLKSGESMKKEKSVTERAESLLGSLKYDLVAEIAKETNLTRKTVVKILQALR
QDTFHYFRVNPESFIQGVTNIINSEKAATLINNIVYSKTDKTYDDSIFTINNFKGSLTKN
ILEVKKHVHNYVKTDSDIERRFATDLECEEVLVYAKLPGGPNGFKIPTPLGNYNPDWAIV
FNTDKFKYVYFIAETKGSMETLQLKEIEQKKISYAKKHFEALGHADIKYDVIDSYQALRD
KIMN
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgatattcaaacaacaaccctaccaaacggatgccactatggcggttgtcggc
tgctttgaagggcaaagcaaaggctttagaaaagaagtggttggcagagaaaccctcgac
cacgggctgtttggcacagaagtcaaagttgaagagatcttctccaataaaaaactggaa
attaccgaagtcgatatattaaaaaatgtgcaagcacttcaaaaagaacagggcttaaaa
accatcagcaaactggatggtctcaactttaccaccgaaatggaaaccggaaccggtaaa
acctatgtctataccaaaaccatgtatgaactcaataaacactacggctggaataagttt
attatcatggtgccatcagtggcgattcgtgagggtgtacataaatcgttagaaattacc
gcagaccattttcaggagatttacggtaaaaaaattcgtttttccatctacaacacccag
aacaaatctaatctgataaacatcaagagctttgccaacacttccaatatcgaagtgctt
atcatgaactatcaggcatttgccaccaccagccaggaatccagaaagatttatcaaaaa
ctcgatacactgcaaagtgaacggcctattgatattattaaacgagccagacccattctg
attattgatgaaccacaacgaatgggtattgaagaaggtaaagttttctctgggaataag
ccatcaaaagtagtcgaagcaatatatcggaataatgaatttaatcacctttgtactcta
ttgtattcagcgacccataaaaaagatttcaataaaatttatcgcctcgatgcaattgat
gcctacaaccagaaactggtgaaaaaaataagtgtcaaagggattgaggttgtcggaaac
agcggaaccaacagctatttgtttttagataaaatccaaatcagcacgagccaatttcca
gttgcctatgttgagttggaagttaaacaggctaacggtattcagaaaaaaatcagacag
ataaaagagaaagatgacctctatgtattctccaatgaattgaaacaatacaaaggcttt
gtggtaaagtcgattaacggtcttaccaataccgtttcattcaccaacggaattaccctc
tctgtagggcaaaccgcaggagacgtggacgaagagcatgttcgccgtatacagattcgg
gaaacgattaaatcccatattgaaaaagaacgaatcatgtttcaaaagggaattaaagta
ctgtcccttttctttatcgatgaagtggtaaagtaccgtgattattcaagtcccgaccag
aaaggcatttatgccaaagtttttgaggatgaataccgccaggcaatcagcgagctaagt
ctttttgaaccggactacaacgactatcttagtaaatttactgtggaagatattcacaaa
ggttacttctccgttgataaaaaaggactgtttatagattccaaagaaaaacgcggcgaa
agcggtagtgatgatgtgagtgcctatgacctcattatgaaaaagaaggaaatacttctt
gatctaaaggaatctacccgttttatattttctcattctgcgcttcgtgaaggttgggat
aaccccaatgtatttcagatttgcactctcaagcacagccaatcagaaatcagcaagcga
caggagataggacgtgggcttcgtatttgtgtcaattcaaaaggcgagcgcatggatgca
tcggtacttgatagtgatttttttgatgtgaataaactcacggtagttgccagtgaatcc
tacgattcctttgccaaagccttgcagaatgaaattgttgaatcactttcagagcgtcca
gttacccttacgattgaggtattaaacaaccgtgtcattcataacgaaaaaggcgaaaag
tttgtttttgatagccagtcctctatggatttgattttcgatatgaaaaccaagggctat
ctggacgcaaattaccatattaccgaagccctgattacagatgtggaaaataaaacttat
gctctcccggaaaagttacaaggttttgaatcttgcgttgctgaacttatgaccggtatc
tacacaacggcaaactttaaagcagcagaaaatgaaaatgccaataatatcaatgaggct
attctaaaacctaacgataactttgccaaaaaagagtttcaggatttatggaagaagatt
aaagtaaaaacggtctatgaagtggattttgaaagtgcagagcttgttgatctctgcgtt
aaggcaattgacaccaatctcaccgttaaaaaaatattgataaatattacttccggtgaa
cagcaagacaagattgacgaggcgacactcaaatccggcgaaagcatgaagaaagaaaaa
agtgttaccgaaagagccgagtctttgctgggttcactgaagtacgatctggtagctgaa
attgccaaagagacaaatcttacccgcaaaacggttgttaaaatattgcaggcattacgg
caggataccttccattacttcagggtaaatccagaaagctttattcagggtgtaaccaat
atcatcaatagcgaaaaagctgcaacccttattaacaacattgtctactcaaaaacagac
aagacatacgatgacagtatttttaccatcaataactttaagggatcactcacaaagaat
attctggaagtcaaaaagcatgttcataactatgtaaagaccgattctgatattgaaaga
agatttgctactgatcttgaatgtgaagaagtgcttgtctatgcaaaactaccaggtggc
ccgaatggttttaaaataccaacaccactgggaaactataatcctgactgggctatcgtt
tttaatactgacaaattcaagtatgtctattttattgcagaaaccaagggaagcatggaa
accttgcaactgaaagaaatagagcagaaaaaaatcagttacgccaaaaagcattttgag
gcattaggacatgcagatattaaatacgatgtgattgattcgtatcaggcattgagagac
aaaataatgaattaa

DBGET integrated database retrieval system