KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_1180Help
Entry
Cphamn1_1180      CDS       T00709                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cphamn1_1180 (recR)
DNA repair and recombination proteins [BR:cpb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cphamn1_1180 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1270892..1271506
Genome map
AA seq 204 aa AA seqDB search
MRYTSTAIEALIEEFAKLPGIGRKTAQRLSMHILQEKPGEVEKLSRALTDVKEKVISCSI
CQNVTDRGDDPCSICRGKGRDLSKICVVESPPDVLAFEKTAQYRGLYHVLHGVISPLDGV
GPDDIKVKELLARLSLQDGREVSEVIMALSPTVEGETTVLYVSRLLKPLGIEVTKIARGI
PVGAELEYIDEATLSRAMEGRSVL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatacttcaacggcgattgaggcactgattgaggagttcgcgaaattgccgggg
ataggccgtaagacagcccagcgactgtctatgcatattcttcaggaaaagccgggagag
gtcgaaaagctttcaagagcgcttaccgatgtgaaggagaaggtgatcagctgttcaatc
tgccagaatgttaccgatcgcggcgatgacccctgttcgatatgtcggggtaaaggccgt
gacctctcgaagatctgtgttgttgagtcgcccccggatgttctcgcatttgaaaaaacg
gctcagtatcgaggtctctatcatgtacttcacggcgttatctctccacttgatggtgtc
gggccggatgatatcaaggtcaaggagcttctggcacgtctctctctgcaagacggcaga
gaggtgagtgaggtgatcatggctctcagtccgacagtggaaggggagacaactgttctg
tacgtgagcaggcttttgaagccactgggcatagaggtgaccaagatagcgagaggaatt
ccggtgggtgccgaacttgaatatatcgatgaggccaccctgtccagggcaatggagggg
cgttcggtgttatag

DBGET integrated database retrieval system