KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_1303Help
Entry
Cphamn1_1303      CDS       T00709                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cpb  Chlorobium phaeobacteroides BS1
Brite
Enzymes [BR:cpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Cphamn1_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1416044..1417045
Genome map
AA seq 333 aa AA seqDB search
MPKKILVTGSTGFIGSRLVRRLLREDSEVYALVRKRSSIEALSDIKDRIHFIEGDITVAS
SLESAFRGMEQVYHAAGFTYMGGRNGKDRLLDAINVDGTRNVMNAALLNNVRRVIHVSSI
TAVGMSKKNGKPFDESSPWNFGEIGLHYAETKRLSEVEVKKAVEKGLDCVIVNPAFVFGA
GDVNFNAGRLIKDVYHRTVPFYPLGGICVVDVEIVADAVVRAMEVGRTGERYILGGDNVT
YKELSNIISRVTGTRRFMFPLPYPIAILVHRFFSVSPFKTRISKLFNPMMFRVASEFLYF
SSEKAIRELDMRTEPIEFSIRRAFEWYKKEGLL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaaaaaaatacttgtaaccggttcgaccggttttattggttctcgtctcgtaaga
agacttctgcgtgaagatagcgaggtctatgctcttgtccggaagcgttcgtccatagag
gctctttcggatataaaagacaggatccactttatcgaaggggatataacggtggcgtcg
tctcttgaaagcgcttttcgagggatggaacaggtctatcatgccgcggggtttacctat
atgggcggcaggaacggaaaggacaggcttcttgatgccattaatgtagacggtacacgc
aacgtcatgaacgcggcactgttgaacaatgtacgccgcgtcatacatgtcagctccata
acggcagtcggtatgtcgaaaaaaaacggcaaaccgttcgatgaatcttctccctggaat
ttcggggaaatagggctgcattacgccgaaaccaaaagactctccgaagtcgaagttaaa
aaagctgtcgagaaaggtctggattgtgttattgtcaatcccgcttttgtgttcggtgca
ggtgacgttaattttaacgcgggcagactaatcaaggatgtctaccatagaacagttcct
ttttatcctcttggcggtatttgtgtcgtagacgtggagatcgtcgctgatgcagttgtt
cgtgctatggaggtcgggcggacaggtgaacgctacattctgggcggagacaatgtgacc
tacaaagagctttcgaatatcatatccagggtgaccgggacgcgaaggttcatgtttcct
ctgccttatccgatcgcaattctcgtgcaccgctttttttctgtttcccccttcaaaacc
cgtatctccaagcttttcaaccccatgatgttcagagttgcctcagagtttttatatttc
tcttcagagaaagcaattcgtgagctcgatatgcggactgaacctattgagttcagtatc
aggcgggctttcgaatggtataaaaaagaagggttgctctaa

DBGET integrated database retrieval system