KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_1588Help
Entry
Cphamn1_1588      CDS       T00709                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cphamn1_1588 (folE)
Enzymes [BR:cpb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cphamn1_1588 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1712501..1713172
Genome map
AA seq 223 aa AA seqDB search
MKQEKTLSDIVANNKTSHSGYSSCADDDCCQENCDTDQEIISSMSEAVYTMLEGIGENPE
REGLKKTPERVARSMRFLTKGYLEDPEEMLKKAVFTESYDEMVLVKEIELFSMCEHHMLP
FFGKAHVAYIPDGKIVGLSKLGRVVDVYARRLQVQERLTQQIRDAIQNVLNPRGVGVVIE
AKHMCMVMRGVEKQNSITTTSAMSGEFLSSQSTRSEFLRLIGL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagaaaaaactctgtcagatatcgtggcgaataacaaaacatcacactccgga
tacagttcctgtgcagatgatgactgttgccaggaaaactgcgataccgatcaggaaatt
atctcaagtatgtccgaagctgtgtacactatgcttgaaggtattggagaaaaccctgaa
cgggaagggctgaaaaaaacgccggaacgtgtcgctcgctcaatgaggttcctcacaaaa
gggtatcttgaagacccggaagaaatgttgaaaaaagctgtctttacagaatcttacgac
gaaatggtgctggttaaggaaatcgaacttttttctatgtgtgaacatcacatgctgccg
tttttcggtaaggctcatgtcgcctacattcctgacgggaaaatcgtgggtctttcgaag
ctcgggagagttgtcgatgtctatgcgcgtcgtctgcaggttcaggaacgtttgacacag
cagatacgtgatgcaatccagaatgtactgaatcccagaggcgtcggtgtcgtgatcgag
gccaagcacatgtgcatggtgatgaggggagttgaaaaacaaaattccataacaacaacc
tctgccatgtcaggtgagtttctgtcttcacaatcgacacgaagcgaatttttacgcctg
ataggactctaa

DBGET integrated database retrieval system