KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_1898Help
Entry
Cphamn1_1898      CDS       T00709                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Cphamn1_1898
Enzymes [BR:cpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Cphamn1_1898
Transfer RNA biogenesis [BR:cpb03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Cphamn1_1898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2061387..2062184)
Genome map
AA seq 265 aa AA seqDB search
MVFEKELLMAVRAALAAGRLIMDVYESEDFEIEKKGDDSPLTRADRAAHESIVHALESTG
LPVLSEEGKSIAYEERKAWKRYWLVDPLDGTKEFISRNGEFTVNIALIDEGVPVLGVVYV
PVLDELFFGSTDEGGYYIPVANGSSGSLDRLLERAYALPLAKNERSYRVVGSRSHMNDLT
TAFIDSVRDEYPDLEIVQRGSSLKICMVAAGDADIYPRFGPTMEWDTAAGHAVVRAAGKS
MIEAGSGKELRYNKEELLNPYFIVW
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggtatttgaaaaagagttgcttatggcggtcagagctgcgcttgctgccggccggttg
attatggatgtctatgagtccgaggacttcgagattgaaaagaagggggatgattctcct
ctgacgagagccgaccgggcggcgcatgagtcgatagtgcatgctctggaatccaccgga
ctcccggtattgagcgaggagggaaagtcgatcgcttatgaagaaaggaaagcatggaag
cggtactggctggtagacccgcttgacgggacgaaagaatttatttcacgtaatggcgag
tttacggtgaatatcgccttgatcgatgagggtgtgccggttctcggtgttgtctatgtt
ccggtactcgatgaactgttcttcggtagtacggacgaggggggatactatattccggtt
gccaatggatcgtcaggcagtcttgaccgactgctggaaagagcatatgctctgcctctg
gcgaaaaacgaaagatcctacagggttgtcggcagccgttctcacatgaatgatctcacc
acggcctttatcgattcagtgagggacgaatatcctgatctcgagatcgtacagcgggga
agctcgttgaagatctgcatggttgccgcaggtgatgctgatatctatccccgtttcggg
ccgaccatggagtgggatacggcagccgggcacgccgtggtcagagctgcggggaaaagc
atgatcgaggccgggagcggaaaggaactgcggtacaacaaagaggagctgctgaacccg
tattttattgtatggtga

DBGET integrated database retrieval system