KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_1988Help
Entry
Cphamn1_1988      CDS       T00709                                 

Definition
hydroxyneurosporene synthase
Orthology
K09844  
carotenoid 1,2-hydratase [EC:4.2.1.131]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Carotenoid biosynthesis
Class
Metabolism; Metabolism of terpenoids and polyketides; Carotenoid biosynthesis [PATH:cpb00906]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2135481..2136611)
Genome map
AA seq 376 aa AA seqDB search
MNITTELDRDIWHNLQEPGSYEWWYFDAEDEEQGISLVCIWFAGFAFSPYYMEHYLGWKQ
NRLAISPKALDYSAFSFQLYENGRESINFIKEGPSSLFESSGNDIDVRFERNRFFYDSQR
QSYVLDVAFDFPARRKKIAAKLVFSVRHRYSYRKTDGNNNGNVPHHEWLLTLPRADVTGS
LTLGDTLRKQSRTLEFHGRGYHDHNLGTMPVHEYIDTWYWGRAFSEEYDLIYYMIFFKNS
AYRPLTLCMLRDNGTGDLTVYEDLRIDKSGLRRGLFAPVHNRNLGFSCDDFRVDIRQRQV
LDSGPFYLRYSSNIVFQKGGLECTSLRGISEFLSPGRLEMSALRFFIRCRVWRHGVRSAM
YGMYNFFKTCLHWIKR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcactacagaactggatcgggatatctggcataatcttcaggagcccggttcc
tatgagtggtggtatttcgacgcggaagatgaagaacagggtatttcccttgtctgtata
tggtttgccggttttgctttctccccgtactatatggagcactatctgggctggaaacag
aacagactcgccatttctccgaaagcactcgattactccgcattcagctttcaactctac
gaaaacggacgtgaaagcattaatttcatcaaagaagggccctcctcactctttgagagc
agcggaaacgatatcgatgtccgctttgagcgtaaccgattcttttatgactctcagcgg
cagtcctatgtactcgatgtggcgtttgattttcctgcacgccgcaagaaaatcgccgcc
aaactggttttcagcgtcaggcaccggtattcctacagaaaaacagacgggaacaacaac
gggaacgttccgcatcacgaatggctgctgacgcttccaagagcggatgtgaccggttcg
ctcacccttggcgatacgctcagaaaacaatcccgcacgcttgagtttcacggaagagga
tatcatgatcacaatctcggtaccatgccggtgcatgaatatatcgatacgtggtactgg
gggcgggcattttccgaggaatacgacctcatctactatatgattttttttaaaaattcc
gcttaccgaccgcttacactctgtatgctgcgcgataacggcaccggagatctcacggtg
tatgaagatctgcgtatcgacaagtcagggctgaggcgcggtttgttcgctcctgtacac
aacaggaatctcggtttttcctgtgatgattttcgtgtcgatatccgtcagaggcaggtt
cttgattcaggcccgttttatctgcgatacagttcgaatatcgtgtttcagaaaggtggc
cttgaatgcacctccctgagaggaatatcggaatttctcagtcccggacggcttgagatg
tcggcgctcaggttttttatccgatgcagggtctggcgccacggggtcaggtctgcgatg
tacgggatgtataattttttcaaaacctgtttgcattggattaaaaggtaa

DBGET integrated database retrieval system