KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_2036Help
Entry
Cphamn1_2036      CDS       T00709                                 

Gene name
valS
Definition
valyl-tRNA synthetase
Orthology
K01873  
valyl-tRNA synthetase [EC:6.1.1.9]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cphamn1_2036 (valS)
Enzymes [BR:cpb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     Cphamn1_2036 (valS)
Amino acid related enzymes [BR:cpb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Cphamn1_2036 (valS)
Transfer RNA biogenesis [BR:cpb03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Cphamn1_2036 (valS)
 Prokaryotic Type
    Cphamn1_2036 (valS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2193396..2196152)
Genome map
AA seq 918 aa AA seqDB search
MQTLSEGDVCIYVWHHKRVMSSNLEKTYNHHDVEGRWNSAHWESLGTFDAESSRVIEGDK
ASYTVLMPPPNVTGSLTLGHVLNHTLQDIFIRYQRMSGREALWLPGTDHAGIATQTVVEK
KLRKDGVSRYDLGRKEFLEHVWKWRDEYGGLILKQLRTLGISCDWRRNLFTMDEGASSAV
RHAFVSLYRDGLIYRGKRIINWCPVSQTALSDEEVIMKPRKDKLVFVRYALAKRPGEYIT
IATVRPETILADVAIAVNPEDPRYRDLVGELAVVPIAGRHIPVIADEYVDIDFGTGALKI
TPAHDPNDFEVAGRHNLPVLSVVGRDGKMIDEFGYAGLDRFEARERITEDLESRGNLVKV
EEYEHNVGYSERADVVVEPYLSEQWFVTMKPLAEKALEVVNDGQIRFHPSHWISTYRHWM
ENIRDWCISRQLWWGHRIPAWYDQEGKIWVAESYEDACHLAGTDKLVQDEDVLDTWFSSW
LWPLTTLGWTGKDEDNKDIQAFYPTDTLVTGPDIIFFWVARMIMAGLYFKGDVPFRDVYF
TSIIRDMKGRKLSKSLGNSPDPLKVIDAYGTDALRFTIVYIAPLGQDVLFGEEKCEFGRN
FATKIWNAARLVFMQREKVFGSSDAFSDLYQGFTPESASLSDAQQWITGRYQEMLGSYHK
AFAQFRMNDITRIVYDFFRGDYCDWYLETLKIELDGERDETKNRHAVCLAVYLLEGILKV
LHPVMPFITEEIWHHILERDSSESIAHAAMPQAVEGWSDDMPKHFSSVQKIISETRSLRA
VFGVPHDMKASLVVSAPEESARRIVTANAHIVTRMTDCSVTIEDGDLPRPPHSASSVVDG
NELFMPLEGLISFEKEIARLEKEADNISSYVTRMEKKLSNKGFVDNAPDEVIEGERSKLA
DAKSNLGKVQASLEVLCN
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgcagacattgtcggaaggcgatgtctgcatttacgtatggcatcataagcgagtaatg
agttcaaacctcgaaaagacctataatcatcatgatgtggagggccgctggaacagcgcg
cactgggagtctctcggtaccttcgatgcggagagttcacgagtgatcgaaggggacaag
gcatcctatacggtgctgatgccgccgcctaacgttaccggcagcctgaccctcggccat
gttcttaaccacaccctgcaggatatatttattcgttatcagcgcatgtcaggacgagaa
gcgctctggctgccgggtaccgatcatgccggtatcgcgacacagaccgtggttgaaaaa
aagcttcgtaaagacggggtgtcgcgttacgacctgggccgcaaggagtttcttgaacat
gtatggaaatggcgggatgagtacggcgggcttattctcaaacagcttcggactcttggt
atttcctgtgactggcggcgtaatcttttcaccatggacgaaggcgcatccagtgcggtt
cgtcacgcttttgtctctctctacagggatggtttgatctatcggggaaaacggatcatc
aactggtgccctgtctcgcagacagcgctttccgatgaagaggtgatcatgaaaccccgg
aaggacaagctggtatttgtccgttatgccctggccaaaagaccgggagagtatatcacg
atagccactgtcaggccggaaaccattctggcggatgttgccatcgcggtcaatccggaa
gatccgaggtatcgtgatctcgttggagagctggccgtcgtcccgattgccggacggcat
attcccgtcattgccgatgagtatgtcgatattgatttcgggacaggtgcgttgaaaatc
acgccggcacacgatccgaatgactttgaggtcgcgggccgtcataaccttcctgttctc
tcggttgtcgggcgtgacggcaaaatgatcgatgaattcgggtacgcgggtcttgaccgt
tttgaggcgagggagaggattacagaggatcttgaaagcaggggtaatctcgtcaaggtc
gaggagtacgagcataatgtgggatactctgaaagagcggacgttgtcgtggaaccctat
ctttccgagcagtggtttgtcaccatgaagcctcttgccgaaaaagcccttgaggtggtc
aatgacggccagatacggtttcatccgtcacactggatcagcacctatcggcactggatg
gaaaatatccgggactggtgtatttcacgccagctctggtggggacacaggatacccgca
tggtatgaccaggaaggaaaaatctgggttgcggaatcttatgaagatgcctgccatctt
gccggaacagataagcttgttcaggatgaggatgtactggatacctggttttcatcgtgg
ctctggccgctgacgacactgggctggaccggcaaggatgaggacaataaggatattcag
gcattttatccgaccgatactcttgtgacagggccggatatcattttcttctgggttgcc
cggatgatcatggccggtttgtatttcaagggggacgtaccgttcagggatgtttacttt
accagcatcatcagggacatgaaaggcagaaaactttccaaatccctcggcaattccccc
gatcccctgaaagttatcgatgcctatgggaccgatgcgcttcgctttaccattgtctac
attgctcctcttggacaggatgtgctgtttggtgaagagaaatgcgagttcggccggaat
tttgccaccaagatatggaacgccgcccggcttgtgttcatgcagcgggaaaaagtgttc
ggctcttctgacgctttcagcgatctctatcagggttttactcctgagtccgcctctctg
tccgatgcccagcaatggataacgggtcgttaccaggaaatgctcggttcctatcacaaa
gcgttcgcgcagttcagaatgaacgatatcaccaggattgtctatgactttttccgtggc
gattattgtgactggtacctggaaaccctgaaaatcgagttggacggagagcgcgacgag
acgaaaaaccgtcatgcggtatgtcttgccgtctaccttttagagggtatactgaaggtg
ctccatcctgtcatgccgtttatcacggaagaaatctggcatcacattctcgaacgtgac
agcagtgaaagcatcgctcatgcagccatgcctcaggcagtggagggatggtcggacgat
atgccgaagcacttctcttccgttcagaaaatcatatcggaaacacgaagccttcgtgcg
gttttcggtgttccgcacgatatgaaagcaagcctggttgtcagtgctcctgaagagtct
gcaaggaggatagttaccgccaacgctcacatcgtgaccagaatgaccgactgcagcgtc
actattgaagatggagatctgccgcgtccgccccattcggcaagttccgtggttgacggg
aatgaactttttatgcctcttgaagggttgatttcgtttgaaaaagagattgcccgactg
gagaaagaggccgacaatatttcttcatatgttacacgcatggagaaaaaactttccaat
aaaggttttgtcgataacgccccggatgaggtgattgaaggtgagcgttcaaagctggcc
gatgcgaaaagcaatctcggcaaagtgcaggccagtctggaagttctctgcaactga

DBGET integrated database retrieval system