KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_2241Help
Entry
Cphamn1_2241      CDS       T00709                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cphamn1_2241
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphamn1_2241
   00052 Galactose metabolism
    Cphamn1_2241
   00500 Starch and sucrose metabolism
    Cphamn1_2241
   00520 Amino sugar and nucleotide sugar metabolism
    Cphamn1_2241
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cphamn1_2241
   00524 Butirosin and neomycin biosynthesis
    Cphamn1_2241
Enzymes [BR:cpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cphamn1_2241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2426351..2427343)
Genome map
AA seq 330 aa AA seqDB search
MSRWALGVDLGGTAVKIAVIDEDAGMLEHERHPTKLDEGPEGIVGQIGSLVFSVYGRFRN
RLGEEGFAGIGLGAPGAVDSERGMLSYPPNLPGWEHYALKSELQKLLIRDYAMDCLLILE
NDANIAACGEAVFGAGRAFSDFMMVTLGTGVGGGILLNRKLYRGPNGTAGEIGYLTIDFG
GKSVHAGVRGTVESLIGKKSIVDMALDTYRLHGREKWSEEIHGSNLCDLSPRTLEKAAHH
GDPVAGEIWDRVGSILGVGLAGVVALMDIRKFVLGGGISGAGNLIFSPAFDQMKRSTLPS
MHDGLELVPAALGNDAGVYGAAALCFSSLL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgatgggcgttgggggtagatcttggggggacggcggtaaaaattgccgttatc
gatgaagatgcgggtatgcttgagcatgaacggcatccgacgaagctcgatgagggaccg
gaaggtattgtcggtcagataggatcgcttgttttctcggtgtacggacgattcagaaat
cgtctcggggaagagggatttgccggtatagggcttggcgctccgggagctgttgacagc
gagcggggtatgctcagctaccctcccaacctgccgggctgggaacactatgcgttgaaa
agtgaattgcagaagcttctcatcagggattatgcaatggactgtttgctgattcttgaa
aatgacgccaatatagctgcctgcggagaagccgtgttcggtgcaggcagagcgttcagc
gattttatgatggtcaccctcggaacgggagtcgggggaggaatactgctgaatcgtaaa
ctctatagagggccgaacggcacggcaggtgagatcggttatctgacgattgatttcggt
ggaaaaagcgttcatgccggtgtcagggggacggtcgaaagtcttataggcaaaaaaagc
attgttgacatggccctcgatacctaccgccttcatgggcgggagaagtggtccgaagaa
atacatggcagcaatctgtgcgatctttctccgagaacgcttgaaaaagccgcacatcat
ggcgatcctgtcgccggagaaatatgggacagggtgggctctattctcggcgttggactg
gctggggtggtcgcattgatggatatccgtaaattcgttcttggcggcgggatttcaggt
gcgggtaacctcattttttctcctgcatttgaccagatgaagcgatctacgctgccttcg
atgcatgatggtctggagctggtgcccgctgccctcggaaatgacgctggagtctatggt
gcagccgcgctctgcttttcttctcttctttga

DBGET integrated database retrieval system