KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_2421Help
Entry
Cphamn1_2421      CDS       T00709                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
cpb  Chlorobium phaeobacteroides BS1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2579584..2582703)
Genome map
AA seq 1039 aa AA seqDB search
MTTDNPILNSPYEEPQRHYATDADGSLNYSDIRDGRRIFVPELQPIPVKQPQGSLLEIND
FAAEFDSHLVNLLRCEIALWRVAEYPGTTRVTKELLIFWFNNPGRHAVRKLFFAQREAVE
TAVWLNEVAEKSNSGQNIMSILQTAHRSVSAEKEQQLPRLAFKMATGTGKTVVMGMLMLY
HLFNRREYRQDTRFADYFLIITPGITIRERLGVLFVDKHSASRQERTDYYALRDLVPRQF
ELALDGLNARLVITNYHALEPKTLQGNKKSPFDGKLDAAGKKQEAKEDFGRLINRLLGSF
RKGSRLLVLNDEAHHCYLPKSSGRTKDNEESDENAKAAIWFSGLVEIAKRFKLQQVYDLS
ATPYYLQGSGYKPYTLFPWVVSDFGLIEAIEAGLVKIPFMPQSDNTQELDMPVLRNLYEH
VSDELPKKGRKKKKSEAKKEGVSITEEPPVLPKLVKGALDQFYNHYREYCDGLRQQFEET
AGLFTSPPVFIVVCNNTSVSKEVYKFIAGYEYERTGKNGNTVREIVDGHYSQFSNYDAST
RQPRHRPPTLLIDSDALENSDQINDEFKKIFASEIAEFKRDYARLKGQGAAEQITDAEIL
REVVNTVGQPGKLGAHIRCVVSVSMLTEGWDANTVTHIMGLRKFGSQLLCEQVAGRALRR
MNYYLQTYRKDTGDIVPETERHRFKQENLVEKFPPEYAHIIGVPFSMFKSGSTTLTPPPD
YTHVTALPERHQELEITFPNVVGYRTEYLDKGIVHDFSGIENYELDFSKFPTEIVMACPF
SPHQETMQVTSVLERRDQELLYLITKELIRYHFADDDQNPRFQLFGDLKNIVEEWYDTKI
VLLNQSDERYRRLLYFENGKTIADHIARGINPHINTEEYIRPVFNYYNRFGSTKYVSGNT
TKETWPTSKSHVNAVVMDSDWEAIAAKTLEEIPEVVSYVKNQFLGFTIPYVKDGKDKLYY
PDFLVRHVTPTRETANLIIEISGMSKDKAEKKWFVHNRWLPAVNAVQEKYGLGRWHFIEI
ANDIRDIRTQLAENIKINL
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgacaatcccatactcaacagtccctacgaagaaccccagcggcattatgca
acagatgccgacggttccttgaattacagcgatatcagggatgggcgtcggatattcgta
ccggaattgcagcctatcccagttaagcagccccaaggatcattgcttgagatcaacgat
ttcgcggcagaatttgacagtcatctggtcaatctgctgcgctgtgagattgcgctttgg
agagttgcggaatatcccggaacaacaagagttacaaaagaactcctgatattctggttc
aacaaccctggtcgtcatgctgtccgcaagctatttttcgctcagcgtgaagcagtagag
actgctgtctggctgaacgaggtggcggaaaaaagcaactctggtcagaacatcatgagc
attctgcagaccgctcatcgttctgtcagtgctgaaaaggaacagcagttgccacgcctc
gcattcaagatggcgacaggaaccggaaagaccgttgtcatggggatgctgatgctctac
catctcttcaacaggcgcgaataccgacaggatacacggtttgctgattatttcctgatt
atcaccccaggcattaccattcgtgagcgtcttggcgtgttgttcgttgataagcacagt
gcaagtcgtcaggagcgcaccgattattacgcacttcgggatcttgtaccccggcaattc
gagctcgctctcgatgggctcaatgcacgcctggtgatcacgaactaccatgccctggag
cctaaaacccttcagggcaacaagaaaagcccgttcgacggcaagctcgatgccgcggga
aagaagcaggaagccaaagaggattttggcaggctgatcaatcgcttgctcggaagcttc
aggaaagggagccgcctgctcgtgctcaacgacgaggcccaccactgttacctgccaaaa
tcgtcgggcaggacaaaggataacgaagaatcggacgagaacgcaaaagcagctatctgg
ttttccggactcgtggaaatagccaaacgcttcaagctgcaacaggtgtatgacttgtcg
gccaccccctactacctgcagggatccggttacaagccctacacgctgtttccctgggtg
gtaagcgacttcgggttgatcgaagctatcgaagcggggctggtgaaaatcccgttcatg
ccgcaaagcgacaatacacaggagctggatatgccggtattgcgcaacctgtatgagcat
gtgagcgatgaactccccaaaaaagggcgcaagaaaaagaaatccgaggcgaaaaaagag
ggcgtgtcgatcaccgaagagccgcctgttcttccgaaactggtcaagggagcgctcgac
cagttctacaatcactaccgggagtattgcgacggcctgcgccagcagttcgaggaaacg
gccggattgttcacctctccgccggtctttatcgttgtctgcaacaatacgtcagtctcc
aaggaggtttacaagttcatcgcagggtatgaatatgaacggacgggcaagaatggtaac
acggtccgcgaaattgtcgatggacactattcgcagttctccaactacgatgcatcgacc
aggcaacccaggcaccgtccgccgacgctccttatcgacagcgacgcgcttgaaaactcc
gaccagatcaacgacgagttcaaaaaaatcttcgcatccgaaattgcagagttcaaacgt
gattacgcgcgcctgaaaggccagggtgctgcggaacagatcaccgatgccgagattctc
cgggaagtggtcaacaccgtcgggcagccgggcaagctgggcgcccacatccgctgtgtt
gtctcggtctcgatgctgaccgaagggtgggacgccaacacggttacccatatcatggga
cttcgcaagttcggctcccagcttctctgcgaacaggttgccggccgggctctgcggagg
atgaattactacctgcagacctacaggaaagacaccggcgacattgttcccgaaacggaa
cgtcaccgcttcaagcaggaaaacctggtcgagaagtttccgcctgaatacgcgcacatc
atcggggtgccgttcagcatgttcaaatccggatcgaccaccctcactcctcctccggac
tacacccatgttacggctctgcctgaacgccatcaggagcttgaaatcacgttccccaac
gtcgtcggctaccggacggaatatctcgacaaagggatcgttcacgatttcagcggtatc
gagaactatgaactggatttttcgaagtttcctaccgagatcgtgatggcatgtccgttc
tccccgcatcaggaaaccatgcaggtgacatccgttctggagagacgggaccaggaactg
ctctacctgatcacgaaggagctgatccgctaccattttgccgacgacgaccagaatcct
cgttttcagctcttcggcgatctgaaaaatatcgtcgaggagtggtacgacacaaagatt
gtgcttctgaaccagtcggatgaacgataccggcgactgctctacttcgagaacggcaaa
accatcgccgaccatattgcacggggtatcaacccgcacatcaacacggaagaatatatc
cggccggtcttcaactactacaatcgctttggtagtacgaaatacgtcagtggcaatacc
acgaaagaaacctggccgacgtcgaaaagccatgtcaatgcagttgtcatggacagtgac
tgggaggccattgcagccaagacactggaggagattcccgaggtcgtttcctatgtcaag
aaccagtttctcggtttcacgatcccgtatgtgaaggatggcaaggacaagctctactat
cctgatttccttgtccgtcacgtaactccaaccagagaaaccgccaacctgatcatcgag
atcagcggcatgagcaaggacaaggccgaaaagaaatggttcgtgcacaaccgctggctg
ccggccgtgaatgccgtgcaggaaaaatacggactcggccgctggcacttcatcgagatc
gccaacgatatccgcgacatcaggacccagttggcggaaaatattaaaatcaacctataa

DBGET integrated database retrieval system