KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_2440Help
Entry
Cphamn1_2440      CDS       T00709                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cphamn1_2440
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Cphamn1_2440
Enzymes [BR:cpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cphamn1_2440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2602647..2603768
Genome map
AA seq 373 aa AA seqDB search
MKQTIVLVFSLLLLTVNACAADLPEEDELSRKIGQMIMVGFRGTSLQEAPGLMQDITKRH
LGGVVLFDYDVPSKSTGRNITSREQLQKLTTGLQQTSAVPLFIAIDQEGGRVSRLKTTCG
FPASVTAAGLGKLNNTDSTFQSSLATAKTLHNSGINVNFAPVVDLNSNPENPVIGSLERS
FSADAAIVYKHARATVEAFHTQNIIAALKHFPGHGSSTTDTHKDFTDITGSWKKNELDPY
RRLIENGYTDLVMTAHVYNANLDNRYPATLSKQIISGLLRDSLGFNGPVISDDMQMQALA
AHYDLRTAITLALEAGVDILLFANNSVYDPDIAEKAVSIIRSLVEEGTLNPNRIDASYKR
IMKLKTHYLKTST
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaccatagttctcgttttctctctcctcctgctcaccgtgaacgcatgtgct
gcggatctgcccgaagaggatgagctcagcaggaaaataggccagatgattatggtcgga
ttcaggggaacctctcttcaggaagcccctgggctcatgcaggatataacaaaacgtcac
cttggaggcgtggttctgttcgactatgacgttccatcgaaatctaccggcagaaacatc
acctcccgtgaacaactccaaaaactgacgaccgggttacagcagacatcggcagttcct
ctttttatcgctatcgaccaggaaggcggcagagtttccagattaaagacaacctgcggc
ttcccggcgagcgtcacggctgccgggctcggcaagctgaacaacactgacagcaccttt
cagtcttcgcttgcaacagcgaaaaccctgcataacagcggcatcaatgtcaatttcgct
cccgttgtcgatctcaacagcaatcctgaaaaccccgttatcggttctcttgaaagaagt
ttttcagcggacgctgcaattgtgtacaaacatgcacgtgcaacagtagaggcgtttcac
acacaaaacattattgccgctctcaaacactttcccggccatggcagctcaactaccgac
acccataaggattttaccgatattaccggaagctggaaaaaaaacgaacttgacccctac
aggcgtctgattgaaaacggctataccgatcttgtcatgactgctcatgtctacaacgcc
aatcttgacaaccgttaccctgcgacactctcaaagcagatcatatcaggcctgttgcgc
gattcccttggatttaacggccctgtcataagcgatgacatgcagatgcaggcgttagcc
gcgcattacgaccttcgaaccgccattaccctggccctcgaagccggcgtagacattctt
ctctttgccaataactcggtctatgatccagatattgccgaaaaagccgtatcgatcatc
cgttcactggtcgaagagggaacgctgaacccgaatcgtatcgacgcctcctacaagcgg
atcatgaaactgaaaacgcactacctgaaaacatcgacatga

DBGET integrated database retrieval system