KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_2473Help
Entry
Cphamn1_2473      CDS       T00709                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Brite
Enzymes [BR:cpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Cphamn1_2473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2639654..2640415)
Genome map
AA seq 253 aa AA seqDB search
MRSDAFGVLIIHGFTATIESVNSLIEPLEKMSLRVSVPVLTGHSESSPEKLRGVTWCDWM
RDAETAFHELSEKVDKVFVVGHSMGALIALNLAAKYQGATLDSVVVAAPSFRLVSMLGPG
RPLHFLAPMLQSFIKSWDLNVAFSDRDVKSREVHYLWAPTDAIMSFFELISFTESRLHDI
RCPMLIMHNRNDQTVTQDSSDIVFNGVGTEPNEKDMVWLERSEHQMFCDCEKDVAIATIV
EYIRSRINQLRSS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcgacgcattcggagttctgattatccatgggtttaccgctacgatcgagagt
gtcaattcgctgatagaaccgcttgaaaagatgtcccttcgtgtcagcgttcctgttctt
acaggtcatagtgaatcttctcctgaaaagctgcggggggtaacctggtgtgactggatg
agagacgccgaaacggcatttcatgagttgtctgaaaaagtcgacaaggtgtttgtggtc
ggccatagcatgggagcgcttattgcactgaatctggcggcaaaatatcagggtgctaca
cttgattctgtcgtggttgcggcgccttcgtttcgtcttgtatccatgcttggtcccgga
agaccgctccactttcttgctcccatgctacagtcattcataaaaagctgggatctcaat
gtcgctttcagtgaccgggatgtgaagagcagggaggtccattatctatgggccccgacc
gatgccatcatgtctttttttgaattgatttcatttaccgagtcgcgccttcacgacatc
cgctgcccgatgcttatcatgcacaaccgtaatgaccagacagtgactcaggacagttcg
gatattgttttcaatggtgttggaactgaaccgaatgaaaaagatatggtctggcttgaa
cgttccgagcaccagatgttctgtgattgcgaaaaggacgttgcgatagcaaccattgtc
gagtatatacgttcccgaatcaatcagttgaggagtagttga

DBGET integrated database retrieval system