KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_2515Help
Entry
Cphamn1_2515      CDS       T00709                                 

Definition
succinate dehydrogenase, membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cphamn1_2515
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cphamn1_2515
   00650 Butanoate metabolism
    Cphamn1_2515
  Energy metabolism
   00190 Oxidative phosphorylation
    Cphamn1_2515
   00720 Carbon fixation pathways in prokaryotes
    Cphamn1_2515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2684480..2684968)
Genome map
AA seq 162 aa AA seqDB search
MSQHYENEGSAASRSKAFVWLMQRVTGVGLVLFLVLHFWVQHMPTGFLATAGEYSEILKT
LSEASPEVVDAIADGKIKEALPGEHVITYSKVLERLRTPLWRIIDILLLLFALLHGMLGL
MNVLGDYMKRVRLRKAVVFCCWAVTLFLAGQGIVVIMAVGMK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacactatgaaaacgaggggtcggcagcttcccgttcaaaggcttttgtctgg
cttatgcagcgggtgaccggagtcggccttgtgctgtttctcgtgcttcatttctgggtt
cagcatatgccgacagggtttcttgctactgccggggagtatagtgaaatactcaagacc
ctttcggaagcaagtccggaagttgttgatgcaattgccgatgggaagatcaaggaagcg
cttcccggcgagcatgtgataacctacagcaaggtgcttgaacggctgcgtactccgctg
tggagaattatcgatattctgctccttctgtttgcccttctgcacggtatgctggggctg
atgaatgttctcggggattatatgaagcgggttcgactgcgaaaggctgtcgtgttctgt
tgctgggcggtgacgctttttcttgcgggccagggcattgttgttattatggctgttgga
atgaaatag

DBGET integrated database retrieval system