KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_2527Help
Entry
Cphamn1_2527      CDS       T00709                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cphamn1_2527
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cphamn1_2527
Enzymes [BR:cpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Cphamn1_2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2697679..2699181)
Genome map
AA seq 500 aa AA seqDB search
MVPLKRLLERLDVSAVVGGIQSEMRIGNITSDSRKASKDTLFVAVRGFVTDGHEFIGDAV
SLGSKAVVCEELPETPAERVLFILVPDARRAMAQIAKAFYGDISDRLSIIGVTGTNGKTT
TARLMAGMMNDCGIRTGYIGTGLALAGDEKILLERTTPEAEELHRLFSIMAERGCRAVVM
EVSSHALVLQRTFGIVFSGAVYTNLTQDHLDFHHTMESYASAKRLLFGAVSPEGFVVVNA
DDPRAGFMAENRGKSRLYCCTVGDSHYACSEGKAFSATLLEAGLQAARVAIDADGRGYDV
LFRLTGLFNVMNLLEVFASGVALGLEPEAVLRSLSTSSPVEGRMEIVRDAAGDFFAVVDY
AHTPDALEKVIGTLNELKPEEGELIVVFGCGGNRDHEKRSVMGRIASRGADRLIITSDNP
RDENPESILDDIAEGIVSPGYMRFCDRAEAIHCGVNLLKEGDILLVAGKGHETCQEKAGA
SSFFSDRETTEEVILARSTH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggtaccgttgaagaggttgttggaacgacttgatgtctctgccgttgtaggcggcatt
cagtctgaaatgcggatcggaaacattacatccgactcacgaaaagcttcgaaagatacg
ttatttgttgcggtgcggggtttcgtgaccgatgggcacgaatttatcggtgacgctgtc
tcccttgggtcgaaggcggtggtctgcgaagagcttccggaaacccctgctgaaagggtt
ctgtttattctcgtgccggatgcaaggagggcgatggcgcagatcgcaaaggctttctac
ggggatatttcggacaggctcagcattatcggggttaccggaacgaacgggaaaaccacg
acggcgcgcctgatggccgggatgatgaacgactgcgggataagaacgggatatatcggt
acagggcttgcattggcaggggatgagaagatcctcctcgagaggacgactcccgaagcg
gaagaactgcatcgtcttttttcaatcatggctgaaaggggttgcagggcggtggtgatg
gaggtttcttctcatgcgcttgtattgcagcgaacattcggaattgttttttctggggcg
gtgtatacgaaccttacgcaggatcatcttgattttcatcatacgatggaatcgtatgcc
tcggccaagcgactgttgttcggcgctgtttcgcctgagggatttgtcgttgtcaacgca
gatgatcccagggccgggtttatggcggaaaacaggggaaaatccaggctctattgctgt
acggtcggcgacagtcattatgcctgcagtgagggaaaagcgttcagtgcgacgcttctt
gaggccgggttgcaggctgcccgggttgcaatagatgcggatggcaggggttatgacgtg
cttttcaggcttacggggctgttcaatgtgatgaatctgctggaggtgttcgcgtcgggt
gtcgccctggggcttgaacctgaagcggttctccgcagcctgtcgacatcgtcacctgtg
gaaggacggatggagattgtcagggatgctgccggtgatttctttgctgtcgtggactat
gctcatacgcctgatgctcttgaaaaagtgatcggaacgctcaacgagctcaagccggaa
gagggtgagctgatcgtggtgttcggatgcggggggaaccgtgaccatgagaaacgatct
gtcatggggcgcatcgcctccagaggggcggacaggcttatcatcacttcggataatccg
agagatgaaaatccggaaagcattctggacgatatcgctgaagggattgtttccccgggc
tatatgcgattttgtgaccgggccgaagcgatacattgcggtgttaacctgctgaaagaa
ggggatatactgcttgtcgcaggaaaaggccatgaaacctgtcaggagaaagcaggcgcc
agcagctttttttccgatcgggaaacgacagaagaagttatacttgcgagaagtactcat
tga

DBGET integrated database retrieval system