KEGG   Chlorobaculum parvum: Cpar_0208Help
Entry
Cpar_0208         CDS       T00725                                 

Gene name
cysS
Definition
cysteinyl-tRNA synthetase (EC:6.1.1.16)
Orthology
K01883  
cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
cpc  Chlorobaculum parvum
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cpar_0208 (cysS)
Enzymes [BR:cpc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Cpar_0208 (cysS)
Amino acid related enzymes [BR:cpc01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Cpar_0208 (cysS)
Transfer RNA biogenesis [BR:cpc03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Cpar_0208 (cysS)
 Prokaryotic Type
    Cpar_0208 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(207181..208647)
Genome map
AA seq 488 aa AA seqDB search
MPSSLHIYNSLTRKKEPFEPIQPGLATIYVCGPTVYGHAHLGHAKSYVSFDVVVRWLRHV
GEQQGYKVRYVQNITDVGHLTDDADEGEDKIQKQARQERIEPMEVAQFYTRSFYEDMDRL
GVERPNIAPTATGHIPEQIALVERLVETGHAYESNGNVYFDVNSFAGYGKLSGRTDQEAL
QSGGRVAERSDKRNPSDFALWKKAEPSHIMKWQSPWGEGYPGWHLECSAMAMKYLGDTID
IHGGGMENKFPHHDCEIAQSEAATGKPFVRYWMHNNMVTVDGVKMGKSLKNFVNLKELFG
TFDPLVIRFFILQSHYRSPLDFSEAAIKASQSGFEKLQETYKRLVESAEDKGQLEVATFE
QKITDALNDDFNTPVAIAVLFEFIKALNGALDKGGLDAASKAAALALLATYAGEVLGILK
SRNELLAGESGESAQTLDDVMQVLLELRKEARANKDFATSDKIRDLLMERGIEVKDTKEG
ATWTKKKA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgccctcttctctgcatatctataattcgcttacccgcaagaaagaaccttttgaaccc
atccagcccggtctggcaacgatctacgtgtgcggcccgaccgtgtacggccacgcccac
ctcggccacgccaaaagctacgtatcattcgacgtggtggtgcgctggctgcgtcatgtc
ggcgagcagcagggctacaaggtgcggtacgtgcagaacattacagacgttggccacctg
accgatgacgccgacgagggggaggacaagatccagaagcaggcgcgtcaggagcgcatc
gagccgatggaggtggcgcagttctacacccgcagcttttacgaggatatggaccggctc
ggcgtcgagcgcccaaacatcgcgccgacggcaaccggccacatcccggagcagatcgcg
ctggtcgagcggcttgtcgaaaccggccacgcctacgaatccaacggtaacgtctatttc
gatgtcaactcgttcgccgggtatggcaagctctccgggcggactgatcaggaggcgttg
cagtcgggcggacgcgtcgcggagcgaagcgacaagcgcaacccctcggacttcgcgctc
tggaaaaaggccgagccaagtcacatcatgaagtggcaatcgccgtggggcgagggctac
cccggctggcatctggagtgctctgcaatggccatgaagtaccttggcgacaccatcgac
atccacggcggtggcatggagaacaagttcccgcaccacgactgcgaaatcgcccagtcc
gaagcggccacgggcaagcccttcgtgcgctactggatgcacaacaacatggtgacggtc
gatggcgtcaagatgggcaagtcgctcaagaacttcgtgaacctcaaggagttgttcggc
acgttcgacccgctggtcatccgcttcttcatcctgcaatcgcactaccgctctccgctc
gacttctccgaagcggccatcaaggcctcgcagtccggcttcgaaaagttgcaggaaacg
tacaagcgattggtagagtcggcggaggacaagggccagctcgaagtggcaacgttcgag
cagaaaatcaccgacgcgctcaacgacgacttcaacacgccggtcgccattgccgtgctt
ttcgagttcatcaaagcgctcaacggcgcgctcgacaaaggcgggcttgacgctgcatcg
aaagccgccgctctggcgcttctcgccacttacgccggagaggtgctcggcatcctgaaa
agtcgcaacgaactgttggccggagagagcggcgaaagcgcacagacgctcgacgacgtg
atgcaggtgctgctcgaactgcgcaaagaagccagagcaaacaaggatttcgccaccagc
gacaaaatccgcgacctgctcatggaacgaggcatcgaagtcaaggacaccaaggaaggc
gcaacctggacaaagaaaaaagcctga

DBGET integrated database retrieval system