KEGG   Chlorobaculum parvum: Cpar_0232Help
Entry
Cpar_0232         CDS       T00725                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cpc  Chlorobaculum parvum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpar_0232
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpar_0232
   00052 Galactose metabolism
    Cpar_0232
   00500 Starch and sucrose metabolism
    Cpar_0232
   00520 Amino sugar and nucleotide sugar metabolism
    Cpar_0232
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cpar_0232
   00524 Butirosin and neomycin biosynthesis
    Cpar_0232
Enzymes [BR:cpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cpar_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
241406..242416
Genome map
AA seq 336 aa AA seqDB search
MPSWAIGIDLGGTNIKTAVIDEAGGILFEDAQPTDSAAGPDGVIRQLALLASDLYQQAAE
SLDTGDFAGIGVGAPGAVDAVKGTLSYPPNLPGWGCYPLRDQLQLRLEQAHGISAPILVE
NDANAAAYGEAVYGGGSAFRDFMLVTLGTGVGGGIILDRKLYRGPTGTAGEIGFMTIDFE
GSSVHAGVRGTIESLIGKERIVELACREGASSGLSPRLLELCDRDVAGLSPRHLEEAAKE
GDQFALRVWQRIGTILGVGLANVTALMDIRKFVIGGGISAAGELIFEPALMQLHRSTLPS
MHDGLEIVPARLGNKAGMYGAAALCFASGKPLRSDD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccttcatgggctatcggcatcgatcttggcgggacgaacatcaagacggccgtcatc
gacgaggccgggggcatacttttcgaggatgcccagccgaccgatagcgccgcgggtccc
gatggcgtgatccgtcagctggcgcttcttgccagcgatctctaccagcaggctgccgaa
tcgctcgataccggcgacttcgcgggcatcggcgttggagcgccgggtgcggtcgatgcc
gtgaagggcacgctctcctatcctcccaatcttcccggctggggatgctatcccttgcgc
gaccagcttcagctccgtctcgaacaggcacatggcatcagcgcgcctatcctcgtggaa
aacgacgccaatgctgccgcgtatggcgaggcggtctacggcggcggcagcgcgttccgc
gacttcatgctggtgacgctcggcaccggcgtgggcggtggcatcattctcgaccggaag
ctctatcgcggcccgactggcacggcgggggagatcggattcatgacgatcgatttcgag
gggtcgagcgtccatgcgggcgtgaggggcacgatcgaaagcctgatcggcaaggagcgg
atcgtcgagctggcatgccgggagggcgcgtcgtccggtctttctccgcgtcttctggag
ctgtgtgaccgtgatgtcgccggcctgtctccacggcatctcgaagaggcggccaaagag
ggtgaccagtttgcgctgcgtgtctggcagcggatcggtaccattctcggcgtcggtctg
gccaatgtcacggcgctgatggacatccggaagttcgtgattggtggcggcatttcggcg
gctggggagctgattttcgagccagccctgatgcagctgcaccgctccactttgccatcg
atgcacgacggactggagatcgttccggccaggcttggcaacaaagccgggatgtatggc
gctgccgcgctctgcttcgcttccggcaagccgctcaggagcgatgattga

DBGET integrated database retrieval system