KEGG   Chlorobaculum parvum NCIB 8327: Cpar_0236Help
Entry
Cpar_0236         CDS       T00725                                 

Definition
nucleoside diphosphate kinase (EC:2.7.4.6)
Orthology
K00940  
nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
cpc  Chlorobaculum parvum NCIB 8327
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cpc00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cpc00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(245247..245669)
Genome map
AA seq 140 aa AA seqDB search
MERTLTILKPDCVRKQLIGAVTDKIERAGFRIVAMKKTRLTKETAGAFYAVHKERPFYGE
LVEFMSSGPCVPMILEKENAVADFRTLIGATDPAEAAEGTVRKLYADSKGENIVHGSDSA
ENAAIEGAFFFAAEEVVRVD
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtacccttaccatccttaagcctgactgcgtgcgcaagcagctcatcggcgcc
gtgaccgacaaaatcgaacgcgccggtttccgcatcgtggcgatgaagaaaacccgcctc
accaaagagactgccggcgcattttatgccgtgcacaaagagcgcccgttctacggcgag
ctggtcgagttcatgtcctccggcccgtgcgtgccgatgattctcgaaaaagagaatgcc
gtcgcagacttccgcacgctgatcggcgcgaccgatccggctgaagccgcagagggcacc
gtccgcaagctctacgccgacagcaagggcgaaaacatcgtccacggctcggactctgcc
gagaacgcagccatcgagggtgcgttcttcttcgccgccgaagaggtcgtgagagttgac
tga

DBGET integrated database retrieval system