KEGG   Chlorobaculum parvum NCIB 8327: Cpar_0274Help
Entry
Cpar_0274         CDS       T00725                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cpc  Chlorobaculum parvum NCIB 8327
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(293428..293940)
Genome map
AA seq 170 aa AA seqDB search
MAQVTAYIGIGSNVGDRLAYLQGAVDRLAGLELTSVTGVSRVYMTEPFGDPDQERYFNAV
VAIETGLDPAGLRTACKAIERDLGRPEEYQRWSPRTIDLDILLYGDRCIETDLLSIPHAE
MHHRKFVIVPLLDIANPQHPRLHCPIADLLRTCGDNSVPVRLADQLSFKS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggtgaccgcgtacatcggcatcggctccaatgtcggagaccggctcgcttac
ctgcagggagccgtcgaccggcttgcagggctggagctgacgagcgtgaccggcgtatcg
cgggtgtacatgaccgagccattcggtgatcccgaccaggagcgctatttcaatgccgtg
gtagccatcgaaacggggctcgaccccgccgggctgcgcactgcgtgcaaagcgatcgaa
cgcgacctcggacggcccgaagagtatcagcgctggagcccgagaaccatcgacctcgac
atcctgctgtacggcgatcgatgcatcgaaaccgatctgctctctattccccatgccgag
atgcaccaccggaaattcgtcatcgtgccgctgcttgacatagcaaatccccagcatccc
cgcctgcattgccccatcgccgacctgctcagaacctgcggagacaattcagtcccggtc
aggcttgcggatcagctctctttcaaaagctga

DBGET integrated database retrieval system