KEGG   Chlorobaculum parvum: Cpar_0518Help
Entry
Cpar_0518         CDS       T00725                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cpc  Chlorobaculum parvum
Pathway
cpc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpc01100  Metabolic pathways
cpc01110  Biosynthesis of secondary metabolites
cpc01130  Biosynthesis of antibiotics
cpc01230  Biosynthesis of amino acids
Module
cpc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpar_0518
Enzymes [BR:cpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cpar_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACF10940
JGI: Cpar0518
UniProt: B3QLY7
Position
556932..557702
Genome map
AA seq 256 aa AA seqDB search
MTYLTRILETKAEEVAELKKQDPERRYHEACGDLPATRDFRSAITSLDGGINLIAEVKKA
SPSRGVLVEDFRPLDIAERYAEIGASAFSVLTDRQYFQGSPDYLKAITQKFSIPVLRKEF
IIDESQIYETRLMGADAALLIVAALEPSQLRDYLQLFAELGLHALVETHDERELDTALEQ
GSTIVGVNNRDLKTFTVDLMTSVRLRQRMPDGIVSVAESGMKHRDDIQMMQEAGFDAVLI
GEGLLVSEELRQFSWG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacctcacccggattcttgagaccaaggccgaagaggtcgccgaactcaaaaag
caggacccggaacgccgctaccacgaagcgtgcggcgatcttccggcgacgcgcgacttt
cgttcggccatcacaagccttgacggtggcatcaatctcatcgctgaagtaaaaaaggca
tcgccctcgcgcggggtgcttgtcgaggatttccgcccgctcgacattgccgaacgctat
gctgaaattggtgcgtcagccttttccgttctcactgatcgccagtatttccagggctcg
cccgactacctgaaggcgatcacgcaaaagttttccattcctgtgctccgcaaggagttc
atcatcgacgagagccagatttacgaaactcgcctcatgggtgccgatgcggcgctgttg
atcgtggcggcgctcgaaccgtcgcagttgcgggactatcttcagcttttcgccgaactc
ggcctgcacgcgctggtcgaaacgcatgacgagcgcgagctcgacaccgcccttgaacag
ggctcgaccattgttggcgtgaacaaccgcgatttgaaaaccttcacggtcgacctgatg
acctccgtgcggctcaggcagcggatgcctgatggcatcgtttcagtagccgaaagcggc
atgaagcaccgtgacgatattcagatgatgcaggaggccgggtttgatgccgttctgatt
ggagagggattgctcgtcagcgaagagctgcggcagttctcgtgggggtag

DBGET integrated database retrieval system