KEGG   Chlorobaculum parvum: Cpar_0538Help
Entry
Cpar_0538         CDS       T00725                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cpc  Chlorobaculum parvum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpar_0538
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpar_0538
   00620 Pyruvate metabolism
    Cpar_0538
   00640 Propanoate metabolism
    Cpar_0538
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cpar_0538
   00680 Methane metabolism
    Cpar_0538
Enzymes [BR:cpc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cpar_0538
Lipid biosynthesis proteins [BR:cpc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cpar_0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(573811..575790)
Genome map
AA seq 659 aa AA seqDB search
MATEQTKGQSSESISSVLSERRKFPPPEAFSSQSHISSMEQYEKLYADAAADPDKYWGDL
AEQFHWFKKWDSVLQWNAPYAKWFNGGTTNIAYNCLDVHVNSWRKNKAAIMWEGEEGNER
ILTYGELHRQVSKFANVLKIAGIKPGDKVAIYMGMVPELVIAVLACARVGAVHNVIFAGF
SAHSITERVNDSHAKLVICSDGTRRRGGTINLKNIVDEAIVNTPSVKNVIVLKVTGEEIH
MHDGMDHWWHDLMGLAMDECEPAQVDSEHPLFLLYTSGSTGKPKGILHTTAGYMVHAASS
FKYVFDIKDEDIYFCTADIGWITGHTYMIYGPLLNGATVFMYEGAPNYPQWDRFWDIINR
HKITILYTAPTAIRAFIRAGNEWVTKHDLSSLRLLGTVGEPINPEAWMWYHKYVGQEKCP
IVDTWWQTETGGIMVSPMPGATPTKPGTATRPLPGIMVDVVRKDGTPCNANEGGYLVVKH
PWPSMLRTIYGDNERYEKTYWSEFPGIYFTGDGARKDDDGYVWIMGRVDDVVNVSGHRLG
TSEVESALVSHEAVAEAAVVSRPDDIKGNALVAFVTLKDGYEGDAKLRDSLGKHVAKEIG
AIAKPDEIRWAKGLPKTRSGKIMRRLLRELATSNEIKGDVTTLEDLGVIENLREQEDEG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggctactgagcaaacgaaaggccagtcctctgaatcgatcagttcggttctctccgag
cggaggaagtttccaccgccggaagcgttctcttcccagtcgcacatttcaagcatggag
cagtacgaaaaactctatgccgatgcagccgcagatcccgacaagtactggggcgatctg
gcggaacagttccactggttcaagaaatgggactcggtgcttcaatggaatgctccgtat
gccaaatggttcaatggcggcacgaccaacatcgcctacaactgccttgacgtacacgtc
aacagctggcgcaagaacaaggcggccatcatgtgggaaggcgaagagggcaacgagcgc
atcctcacctatggcgaactgcaccgccaggtcagcaaattcgccaacgtcctgaaaatc
gccggtatcaaaccgggtgacaaagttgccatctacatgggcatggtgcccgaactggtc
atcgccgtgctcgcctgtgctcgtgtcggtgcagtgcacaacgtgatcttcgccggcttc
tcggcacactccatcaccgagcgcgtcaacgactcccacgccaagctggtcatctgctcc
gacggcacccgccgccgtggtggcaccatcaacctcaagaatatcgtcgacgaagcgatc
gtcaacactccttcggtcaaaaacgtcatcgtcctcaaagtgaccggcgaagagatccac
atgcacgacggcatggatcactggtggcacgacctgatgggcctggccatggacgaatgc
gaaccggcacaggtcgattccgagcacccgctctttttgctctacaccagcggctcaacc
ggcaaaccgaaaggcatcctgcacaccaccgccggctatatggtgcacgctgccagctcg
ttcaaatatgtgttcgacatcaaggacgaagacatttacttctgcaccgccgacatcggc
tggatcaccggccacacctacatgatctacggcccgctgctcaacggcgcgaccgtcttc
atgtacgaaggtgcgccgaactacccgcagtgggatcgcttctgggacatcatcaaccgc
cacaagatcacgattctctacaccgctccaacggccatccgtgccttcatccgcgccggt
aacgagtgggtcaccaagcacgacctcagctcgctcaggctgctcggcacggtcggcgaa
ccgatcaaccccgaggcctggatgtggtatcacaagtatgtcggtcaggagaagtgcccc
atcgtggacacctggtggcagaccgaaaccggcggcatcatggtctccccgatgccgggc
gcaaccccgaccaagccgggcacggccacccgcccgctgccgggcatcatggtcgatgtc
gtgcgcaaggacggcacgccgtgcaacgccaacgaaggcggctacctggtcgtcaaacac
ccgtggccctcgatgctccgcaccatttacggcgataacgagcgctacgaaaagacctac
tggtcggagttccccggcatctacttcaccggcgacggtgcgcgcaaggacgatgacggc
tacgtctggatcatgggtcgcgtcgatgacgtggtcaacgtctccggccaccgcctcggc
accagcgaggtcgagagcgctctcgtctcccacgaagcggtcgcggaagccgccgtggtc
agccgtccggacgacatcaagggcaacgcgctggtcgcattcgtgacgctgaaggatggc
tacgaaggcgatgccaaactgcgcgactcgctcggcaagcatgttgccaaggagatcggc
gccatcgccaagccggacgaaatccgctgggccaaaggtctgccgaaaacccgcagcggc
aaaatcatgcgccgcctgcttcgcgagctcgccacctccaacgagatcaaaggcgacgtc
accaccctcgaagaccttggcgtcatcgagaacctccgcgaacaggaagacgaaggctga

DBGET integrated database retrieval system