KEGG   Chlorobaculum parvum: Cpar_0761Help
Entry
Cpar_0761         CDS       T00725                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpc  Chlorobaculum parvum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cpar_0761
Enzymes [BR:cpc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cpar_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(817993..820194)
Genome map
AA seq 733 aa AA seqDB search
MTTPADTHEERLSGSVERVTFHSEESGFTVLRLRVAGQREPVAVVGLAASPAVGEFMECV
GTWQNDRTHGLQFKATKITPVQPTTLEGKERYLASGQVKGLGNYYAKKLIEQFGDAVFDV
IENEPERLLEVPGIGRKRLDMVIESWTEQRAIRDIMLFLQEHGVGAARAWKIYRRYREGA
IATITENPYRLSLDIEGIGFQTADTIAASLGVERNSLMRAEAGITHVLGQMSSDGHCAVP
EETLIGEASRLLEIDRPLVAEAVTNEKLTRRIVGETIDEVPCIFLESLHRAETGVASALH
RLKRGPLPWEPLDPHDVLPWIEEQTGLELSPSQRSAVTLVLASKVSIITGGPGVGKTTIL
KAILSVLQREKVSVALCAPTGRAAKRLTESTGIEAKTIHRLLEFDPQIFDFKRGRGNPLD
VSFVVVDETSMVDVVLMQKLVAAIPDRAAVVFVGDVDQLPSVGPGAVLADLIASEVIPTV
CLTEIFRQAAESMIVVNAHRINQGEMPLTDEGEELSDFYIVPASSPEAIHDKVMQLVTER
IPKRFDLDPVRDVQVLTPMNKGGIGVQALNAELQARLNPTAEPKVTRFGSTFAPGDKVIQ
TVNNYDKEVFNGDIGLIEQIDTDAETLTALFDHHHVEYDFSDLDELSLAYAISIHKSQGS
EYPAVVIPLSMQHYPLLERNLAYTAVTRGRKLVVIVAEPKALDRAIRNCKSKRRLTGLVQ
RLKESGKQSWQNL
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacccgccgacacccatgaagagcgcctctcgggttccgtcgagcgggtaacg
tttcacagcgaggaatctggcttcacggtgctgcgcctgcgggttgccgggcagcgcgag
ccggtggcggtggtcggcctcgctgcctcgcctgccgtgggcgagttcatggagtgcgtt
ggcacgtggcagaacgaccgcacgcacggcttgcagttcaaggcgacgaaaataaccccc
gtacagcccaccacgctcgaaggcaaggagcgctacctcgcatcggggcaggtgaaggga
cttggcaactattacgcaaaaaagctgatcgagcagtttggcgacgcggtgttcgatgtg
atcgaaaacgaaccggagcgactactcgaagtgccaggcatcggacgcaagcggctcgac
atggtgatcgaatcgtggactgagcagagagccatacgggacatcatgctctttctgcag
gagcacggcgtcggcgcagcaagggcctggaaaatctaccgccgctaccgcgaaggggcc
atcgccaccatcacggaaaatccctaccgcctctcgctcgacatcgaaggcatcggcttc
cagacggccgacaccatcgctgcgagccttggcgtcgaacggaactcgctcatgcgggcc
gaagcgggcatcacccatgtgctcggccagatgtcgagcgacggccactgcgccgttccg
gaagagacgctcatcggcgaagcctcacgcctgctcgaaatcgaccgcccgctcgttgcc
gaagccgtgacgaacgaaaagctgacccgccgaatcgtaggtgaaacgatcgacgaagtg
ccgtgcatctttctcgaatcgctgcaccgcgccgaaacgggcgtcgcctcggcgctgcac
cgactgaagcgtggccccctgccgtgggagccgcttgatccgcacgatgtgctgccgtgg
atcgaggagcagaccggccttgagctctccccttcgcaacgcagcgcggtgacactcgtg
ctggccagcaaagtatcgatcatcaccggcgggccgggcgtcggcaagaccaccatcctc
aaggcgatcctctcggtgcttcagcgcgaaaaggtctccgtggcgctctgcgctccgacc
ggccgggcagccaagcggctcaccgaatcgaccggtatcgaggccaaaaccatccatcgc
ctgctcgaattcgatccgcagattttcgatttcaaacgaggacgcggcaatccgctcgac
gtttcgttcgtggtggttgacgaaacctcgatggtggacgtcgtgctgatgcagaagctc
gtggcggcgattcccgaccgcgcggcggtggtcttcgtcggcgacgtcgatcagttgcca
tcggttggccccggcgcggtgctcgccgacctgatcgcctcggaggtcatccccaccgtc
tgcctgaccgaaatcttccggcaagccgccgaatcgatgatcgtcgtcaacgcccaccgc
atcaaccagggcgaaatgccgctgaccgacgagggcgaggagctttccgatttctacatc
gttccggcaagttccccggaggcgattcacgacaaggtgatgcagctcgtcacggagcgc
atcccgaaacgcttcgatctagacccggtgcgtgacgtgcaggtgctgacaccgatgaac
aagggcggcatcggcgtacaggccctgaacgccgagctgcaggcgcgcctcaacccgacc
gccgagccgaaagtgacccgcttcggcagcaccttcgcgccgggtgacaaagtgattcag
acagtcaacaactacgacaaagaggtcttcaacggcgacattggcctgatcgaacagatc
gacaccgatgcggagacgctgacggcgctcttcgaccatcaccacgtcgagtacgacttc
agcgacctcgacgaactgtcgctcgcctatgccatcagcatccacaaaagccagggctca
gaatacccggcagtggtcattccgctctccatgcagcactaccccctgctcgaacgcaac
cttgcctatacggccgtcacgcggggacgcaagctcgtggtcatcgttgccgaaccgaag
gcgcttgaccgggcgatcaggaactgtaaatcgaaacgccgcctgaccggcctcgtgcaa
cggctcaaagagtccggaaaacaaagctggcaaaatttgtaa

DBGET integrated database retrieval system