KEGG   Chlorobaculum parvum NCIB 8327: Cpar_0800Help
Entry
Cpar_0800         CDS       T00725                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cpc  Chlorobaculum parvum NCIB 8327
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(867991..869292)
Genome map
AA seq 433 aa AA seqDB search
MRVAVIGSGISGIAAAFYLAKRQVRVDLFESEKQIGGRVGSDLLQGRWVDFGGKNIGNYY
NHFREFAKTYGNPEYEYFGINTSQLLNGRLISISREGYPLLNIFKLVQLCGLQGIIRLYP
HIKAIWNDRSQGVLGSDCFKSLSDQFDHLTLDQYLNRQCIDNVIRPITVRMNGAEPEECY
PGNFGSNLGLALDSFEQLSIGMHDLLNTFANNYESDSHRILTGHHITAITKDRDTFRIDY
LHQGIPGTGNYDKVISALPAHSLAALLQNERPEVAELLRQISYYPVSVAIVKYSDDVFQK
KRRAMVFGRNLPLSNAGAYGLNDLDMVRYTFSGKASRAAITEKTSPEEAIELAEKLASPY
FNIQNNKKEGFVYRYFSKGLCAYSSRHHLLLEKIDKYISSFTGFGYTGDYRRGASIEACF
RAAHECVETVIGN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtagcagttattggtagcggaatatcaggcattgctgctgcattttaccttgcc
aaacggcaagtaagggtagacctttttgaatctgaaaaacaaataggcggtagagttggt
agcgatttactgcaagggcgctgggtagatttcggcggtaaaaacattggaaattactac
aatcatttccgtgaatttgccaagacatacggaaatccagaatacgaatattttggaatc
aacacatcccagctgcttaacggacgcctcatctccattagccgcgaaggatatccattg
cttaacattttcaagctcgttcaactgtgcggcttgcaaggaattattcgtctttaccct
cacatcaaagcaatctggaatgaccgaagccaaggggtgctaggcagtgattgtttcaaa
tcgctgagcgatcagtttgaccatctcactcttgaccaatacctcaaccgccagtgtatc
gacaatgtaataagaccgatcacagtaagaatgaacggggctgagcccgaggaatgctat
cccggtaattttggctcgaaccttggccttgccttggacagcttcgaacaattgagcatt
ggaatgcatgatctgctcaataccttcgcaaacaattatgagtcagattcgcaccgaata
ctgaccgggcaccatatcaccgctataaccaaagacagggatacgtttcgcatagattac
ctgcaccagggaattcctggcacggggaattatgacaaagtcatttcagcccttcctgct
catagcttggcagctttactccagaatgagagaccggaagtagcagaattgcttcgtcaa
atcagctattatcctgtaagcgtagccattgtaaaatacagcgatgacgtatttcagaaa
aaacgtcgggcgatggttttcggccgtaatttaccattgagtaatgcgggagcttatgga
cttaatgatctggatatggtcagatatacttttagtggtaaagcatcaagagccgcaatc
actgaaaaaacgtcccctgaggaggcaattgaacttgctgaaaagctagcaagtccttac
tttaatatccagaacaataaaaaagagggctttgtgtaccgatacttctctaaagggtta
tgcgcatactcatccaggcatcatctgcttcttgaaaaaatagataagtatatcagtagt
tttacaggcttcggatacactggggattatcgtcggggagcttcgattgaggcctgtttc
agggcagctcatgagtgtgtggaaaccgtaattgggaattga

DBGET integrated database retrieval system