KEGG   Chlorobaculum parvum: Cpar_0800Help
Entry
Cpar_0800         CDS       T00725                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cpc  Chlorobaculum parvum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpar_0800
Enzymes [BR:cpc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Cpar_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(867991..869292)
Genome map
AA seq 433 aa AA seqDB search
MRVAVIGSGISGIAAAFYLAKRQVRVDLFESEKQIGGRVGSDLLQGRWVDFGGKNIGNYY
NHFREFAKTYGNPEYEYFGINTSQLLNGRLISISREGYPLLNIFKLVQLCGLQGIIRLYP
HIKAIWNDRSQGVLGSDCFKSLSDQFDHLTLDQYLNRQCIDNVIRPITVRMNGAEPEECY
PGNFGSNLGLALDSFEQLSIGMHDLLNTFANNYESDSHRILTGHHITAITKDRDTFRIDY
LHQGIPGTGNYDKVISALPAHSLAALLQNERPEVAELLRQISYYPVSVAIVKYSDDVFQK
KRRAMVFGRNLPLSNAGAYGLNDLDMVRYTFSGKASRAAITEKTSPEEAIELAEKLASPY
FNIQNNKKEGFVYRYFSKGLCAYSSRHHLLLEKIDKYISSFTGFGYTGDYRRGASIEACF
RAAHECVETVIGN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtagcagttattggtagcggaatatcaggcattgctgctgcattttaccttgcc
aaacggcaagtaagggtagacctttttgaatctgaaaaacaaataggcggtagagttggt
agcgatttactgcaagggcgctgggtagatttcggcggtaaaaacattggaaattactac
aatcatttccgtgaatttgccaagacatacggaaatccagaatacgaatattttggaatc
aacacatcccagctgcttaacggacgcctcatctccattagccgcgaaggatatccattg
cttaacattttcaagctcgttcaactgtgcggcttgcaaggaattattcgtctttaccct
cacatcaaagcaatctggaatgaccgaagccaaggggtgctaggcagtgattgtttcaaa
tcgctgagcgatcagtttgaccatctcactcttgaccaatacctcaaccgccagtgtatc
gacaatgtaataagaccgatcacagtaagaatgaacggggctgagcccgaggaatgctat
cccggtaattttggctcgaaccttggccttgccttggacagcttcgaacaattgagcatt
ggaatgcatgatctgctcaataccttcgcaaacaattatgagtcagattcgcaccgaata
ctgaccgggcaccatatcaccgctataaccaaagacagggatacgtttcgcatagattac
ctgcaccagggaattcctggcacggggaattatgacaaagtcatttcagcccttcctgct
catagcttggcagctttactccagaatgagagaccggaagtagcagaattgcttcgtcaa
atcagctattatcctgtaagcgtagccattgtaaaatacagcgatgacgtatttcagaaa
aaacgtcgggcgatggttttcggccgtaatttaccattgagtaatgcgggagcttatgga
cttaatgatctggatatggtcagatatacttttagtggtaaagcatcaagagccgcaatc
actgaaaaaacgtcccctgaggaggcaattgaacttgctgaaaagctagcaagtccttac
tttaatatccagaacaataaaaaagagggctttgtgtaccgatacttctctaaagggtta
tgcgcatactcatccaggcatcatctgcttcttgaaaaaatagataagtatatcagtagt
tttacaggcttcggatacactggggattatcgtcggggagcttcgattgaggcctgtttc
agggcagctcatgagtgtgtggaaaccgtaattgggaattga

DBGET integrated database retrieval system