KEGG   Chlorobaculum parvum NCIB 8327: Cpar_0818Help
Entry
Cpar_0818         CDS       T00725                                 

Definition
phosphoribosylformylglycinamidine synthase I (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
cpc  Chlorobaculum parvum NCIB 8327
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cpc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
889004..889762
Genome map
AA seq 252 aa AA seqDB search
MADLNVGVVVFPGSNCDHDTEYAVASFSGVKPVMLWHNEHDLKGCDAIILPGGFSYGDYL
RCGSIARFSPIMREVIDFAGQGRPVLGICNGFQVLVESGLLEGALIRNAGRKFICRQSTI
SVVNNSTIFTDRYEKGEVLRVPVAHGEGNYYASVETIDSLESNGQVVFRYTDAEGNATAE
ANFNGSLNNIAGITNKQGNVLGLMPHPERASEELLGSGDGRRVFESLFAHLAGTKRSSRG
CCSTSPTRRSAS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctcaacgttggcgtcgtggtgtttcccggttcgaactgcgaccacgatacc
gaatatgccgttgcctcgttttccggagtcaagccggtcatgctctggcacaacgagcac
gacctgaaaggctgcgacgcgattattctccctggtggcttctcctacggcgattacctc
cgctgtggctccatcgcccgcttctcgccgatcatgcgtgaagtgatcgacttcgcaggg
caaggccgtccggtgctcggcatctgcaacggttttcaggtgctggtcgaaagcggcctg
ctcgaaggcgcgctgatccgcaacgctggtcggaagtttatctgccgtcagtcaaccatc
agcgtggtgaacaactcgaccatctttaccgatcgttacgaaaagggcgaagtgcttcgc
gtgccggttgcgcatggtgagggcaactactacgcctccgttgagaccatcgacagcctc
gaatcgaacggccaggtggttttccgttatactgatgcggaaggcaatgctactgccgaa
gctaatttcaacggatcgctgaacaacatcgccggtattaccaacaagcagggcaacgtg
ctcggcctgatgccgcatcccgagcgggccagcgaagagctgctcggctctggtgatggc
cgcagagttttcgaatccctgtttgctcatcttgccggaacaaaaagatcttctcgtggc
tgctgttcgacttcgccaacacgtcgttcagcgtcatga

DBGET integrated database retrieval system