KEGG   Chlorobaculum parvum: Cpar_0818Help
Entry
Cpar_0818         CDS       T00725                                 

Definition
phosphoribosylformylglycinamidine synthase I (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
cpc  Chlorobaculum parvum
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cpar_0818
Enzymes [BR:cpc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     Cpar_0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
889004..889762
Genome map
AA seq 252 aa AA seqDB search
MADLNVGVVVFPGSNCDHDTEYAVASFSGVKPVMLWHNEHDLKGCDAIILPGGFSYGDYL
RCGSIARFSPIMREVIDFAGQGRPVLGICNGFQVLVESGLLEGALIRNAGRKFICRQSTI
SVVNNSTIFTDRYEKGEVLRVPVAHGEGNYYASVETIDSLESNGQVVFRYTDAEGNATAE
ANFNGSLNNIAGITNKQGNVLGLMPHPERASEELLGSGDGRRVFESLFAHLAGTKRSSRG
CCSTSPTRRSAS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctcaacgttggcgtcgtggtgtttcccggttcgaactgcgaccacgatacc
gaatatgccgttgcctcgttttccggagtcaagccggtcatgctctggcacaacgagcac
gacctgaaaggctgcgacgcgattattctccctggtggcttctcctacggcgattacctc
cgctgtggctccatcgcccgcttctcgccgatcatgcgtgaagtgatcgacttcgcaggg
caaggccgtccggtgctcggcatctgcaacggttttcaggtgctggtcgaaagcggcctg
ctcgaaggcgcgctgatccgcaacgctggtcggaagtttatctgccgtcagtcaaccatc
agcgtggtgaacaactcgaccatctttaccgatcgttacgaaaagggcgaagtgcttcgc
gtgccggttgcgcatggtgagggcaactactacgcctccgttgagaccatcgacagcctc
gaatcgaacggccaggtggttttccgttatactgatgcggaaggcaatgctactgccgaa
gctaatttcaacggatcgctgaacaacatcgccggtattaccaacaagcagggcaacgtg
ctcggcctgatgccgcatcccgagcgggccagcgaagagctgctcggctctggtgatggc
cgcagagttttcgaatccctgtttgctcatcttgccggaacaaaaagatcttctcgtggc
tgctgttcgacttcgccaacacgtcgttcagcgtcatga

DBGET integrated database retrieval system