KEGG   Chlorobaculum parvum NCIB 8327: Cpar_0835Help
Entry
Cpar_0835         CDS       T00725                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cpc  Chlorobaculum parvum NCIB 8327
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
907614..908228
Genome map
AA seq 204 aa AA seqDB search
MRYSSGAVEALIEEFAKLPGIGRKTAQRLTMHVLQERRGEVEKLAAALIDVKEKVVRCSI
CQNITDLGTDPCLLCTSTGRDRSVICVVESPTEVLAFEKTGHYKGLYHVLHGVISPLDGV
GPDDIKVRELLARISPDSEGGVREVVLALNPTVEGETTSLYISKLLKPLGINVTRIARGI
PVGAELEFIDEATLSRAMDGRSAV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacagctcaggagccgtcgaggcgctcatcgaagagtttgccaaactgcccggt
attggccggaagaccgcacagcgcctgacgatgcatgtgctgcaggagaggcgcggagag
gttgaaaaacttgcggctgccctgatcgacgtcaaagagaaggtggtgcgctgctcgatc
tgccagaacatcaccgatctcggcaccgacccctgcctgctctgcacctcaacaggtcgt
gaccgctcggtcatctgtgttgtcgaatcgcccacagaagtgctcgcctttgaaaaaaca
ggtcattacaaaggactgtaccacgtgctgcacggggtgatttcgccgctcgacggcgtt
ggtcccgacgacatcaaagtgcgtgaactgctggctcgaatcagccctgattcggagggc
ggggttcgtgaggtggtactggcgctcaatcccacggtcgagggggaaacgacctcgctc
tatatcagcaaactgctcaaaccactcggcatcaacgtcaccagaatcgccagaggaatt
ccggtgggtgccgagcttgaattcatcgacgaagcgaccctttcgcgggcgatggatggg
cggtcggccgtctga

DBGET integrated database retrieval system