KEGG   Chlorobaculum parvum NCIB 8327: Cpar_0980Help
Entry
Cpar_0980         CDS       T00725                                 

Definition
sugar-phosphate isomerase, RpiB/LacA/LacB family (EC:5.3.1.26)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
cpc  Chlorobaculum parvum NCIB 8327
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:cpc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpc01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cpc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cpc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1082936..1083370
Genome map
AA seq 144 aa AA seqDB search
MNIAVGSDHAGVEMKKSVIAWLEKNGHTAEDMGPYTEESVDYPDFAHKVCSAVLEGKADQ
GILMCGTGIGMSIAANKVKGIRAGLACGPEFAALARQHNNANVLCFAARFNDVPTAEKIL
ESWFASEFEGGRHQRRVDKLEAGS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgcagttggaagcgaccacgcaggcgtggaaatgaagaaaagcgtcatcgcc
tggctcgaaaagaacggccacaccgctgaggatatggggccatataccgaagagtcggtc
gattaccccgatttcgcccataaggtgtgcagcgcagttctggaaggcaaagccgatcag
gggattctgatgtgtggcaccggtatcggcatgtccatcgcggccaacaaggtgaagggc
attcgcgccgggctggcgtgcggccctgaattcgcggcacttgcccgtcagcacaacaac
gccaacgtgctctgctttgcggcgcgcttcaacgatgtgcccactgccgagaagattctc
gaaagctggtttgcttcggagttcgagggaggccgtcaccagcgccgtgtcgataaactt
gaagccggtagctga

DBGET integrated database retrieval system