KEGG   Chlorobaculum parvum: Cpar_1008Help
Entry
Cpar_1008         CDS       T00725                                 

Definition
ATP-grasp domain-containing protein
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
cpc  Chlorobaculum parvum
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpar_1008
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpar_1008
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cpar_1008
Enzymes [BR:cpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Cpar_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1113570..1114766
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVIMDPDRLAQLGEANKWLRESKLVVKAHEAIGGRFK
LGLVKIGLNLEQAIEAAKEMLGAKVGTAEIGQVIIAEMLEHDAEFYVSIIGNKDGAELLI
SKHGGVDIEDNWDSVRRIQIELDENPTIERLTELAKDAGFEGEIAERVGKICSRLILCFD
NEDAQSIEINPLVIRKSDMRFAALDAVMNVDYDARFRHADWDFKPVSEIGRPFTEAEQQI
MEIDSRIKGSVKFVEVPGGEIALLTAGGGASVFYADAVVARGGTIANYAEYSGDPADWAV
EALTETICRLPNIKHIIVGGAIANFTDVKATFSGIINGFRESKSKGYLEGVKIWVRRGGP
NEAQGLAAIKQLQEEGFDIHVYDRSMPMTDIVDMAMKS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaattcttgaagggccggccatgaagttgttcaacaaatggggcattcctgtg
cctaattatgttgtcatcatggaccctgaccgtcttgcacagcttggtgaagctaataaa
tggctgcgtgaatcgaaactcgtcgtcaaggcacacgaagccatcggcggccgtttcaaa
ctcggtctcgttaaaattggtcttaatctcgaacaggccatcgaagctgccaaagagatg
cttggcgccaaagtcggcacggctgaaatcggccaggtcatcatcgctgaaatgctcgag
catgacgcggagttctacgtttcgattatcggtaacaaagatggcgctgaactgctgatt
tccaagcacggcggcgtcgatatcgaagacaactgggacagcgtccgccgtatccagatc
gaactcgacgagaatcccaccatcgagcgactcaccgagcttgccaaggatgccggtttc
gaaggcgaaatcgccgagcgcgtcggcaagatctgctcccgtctcattctctgtttcgac
aacgaggacgcacagtccatcgaaatcaacccgctggttatccgcaagagcgacatgcgc
ttcgccgcgcttgacgccgttatgaacgtggactatgatgcccggttccgccatgccgac
tgggatttcaagccggtttccgaaatcggccgtccgttcaccgaagccgagcagcagatc
atggagatcgactccaggatcaagggttcggtcaagttcgttgaggttcccggtggtgaa
atcgctctgctgaccgcaggcggcggcgcatcggtcttctatgccgacgcagtcgtggct
cgcggcggaaccatcgccaactatgcagaatattcgggcgacccggccgactgggctgtg
gaagcgctcaccgaaaccatctgccgtctgcccaacatcaagcacatcattgtcggcggc
gctatcgccaactttaccgacgtgaaggctaccttcagcggtatcatcaacggcttccgc
gaaagcaagtcgaagggctacctcgaaggcgtaaaaatctgggtgcgccgtggcggcccg
aacgaagctcagggccttgccgctatcaagcagctccaggaggaaggcttcgacattcac
gtctacgaccgcagcatgccgatgaccgatatcgtcgatatggcgatgaagtcttga

DBGET integrated database retrieval system