KEGG   Chlorobaculum parvum: Cpar_1277Help
Entry
Cpar_1277         CDS       T00725                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cpc  Chlorobaculum parvum
Pathway
cpc00010  Glycolysis / Gluconeogenesis
cpc00071  Fatty acid degradation
cpc00350  Tyrosine metabolism
cpc00625  Chloroalkane and chloroalkene degradation
cpc00626  Naphthalene degradation
cpc01100  Metabolic pathways
cpc01110  Biosynthesis of secondary metabolites
cpc01120  Microbial metabolism in diverse environments
cpc01130  Biosynthesis of antibiotics
cpc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpar_1277
  Lipid metabolism
   00071 Fatty acid degradation
    Cpar_1277
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cpar_1277
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cpar_1277
   00626 Naphthalene degradation
    Cpar_1277
Enzymes [BR:cpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cpar_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ACF11680
JGI: Cpar1277
UniProt: B3QP27
Position
complement(1388817..1389845)
Genome map
AA seq 342 aa AA seqDB search
MMRAMLLERITDLHVEAEPLVFREVPVPEPQRGELLLRVGACGVCHTELDEIEGRTSPPR
FPVILGHQVVGRVVACGDGVAGIEIGSRRGVAWIFSSCGHCSLCLSGNENLCPEFRATGR
DADGGYAEYMTVLADFTYPVPDVFTDAEAAPLLCGGAIGYRSLMLANLRDGQILGLTGFG
ASGHQVLKLSRYLFPKSPVFVFARSEKDREFALSLGADWVGEITADPPEPCDSIIDTTPA
WLPVLSALERLRPGGRLVINAIRKESRDNDLLAGISYERHLWMEKEIKSVANITRADVSA
FLDIAARMGLKPEVRCYPLEEANRALLDLRHGRAKGAAVLIP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtgcgatgttgcttgagcggattaccgatctgcatgtggaagcggagccgttg
gtgtttcgtgaggtgccagtgcccgagccgcaacggggcgaactgctgcttcgggtgggc
gcgtgtggcgtttgtcatacggagctcgatgagatcgaggggcggacgtcaccgccacgc
tttccggtcatcctcggacaccaagttgtagggcgcgtcgtcgcttgcggcgatggcgtc
gcaggcatcgagatcggcagccgccgcggcgtggcttggattttctcctcgtgcggccac
tgttcgctctgcctttcaggcaacgaaaacctctgcccggagttccgtgcgaccgggcgc
gatgctgacggtggctatgccgagtatatgactgtgctcgcggattttacctatcccgtt
cccgacgtgtttaccgatgccgaagcagcgccgcttttgtgtggtggtgcgattggctat
cgctcgctgatgctcgcaaatctccgcgatggccagattctcggcctgaccggctttggc
gcttcgggccatcaggtgctcaaactttctcgttacctctttcccaaatctccggttttt
gtcttcgctcgtagcgaaaaggatcgtgagttcgccctctcgctcggcgcggactgggtt
ggggaaatcaccgccgatccgccggaaccgtgcgattccattatcgacacgacgcccgcc
tggttgccggtgctctcggcactcgaacggctgcggcccggcggacggctcgtcattaac
gctatccgcaaggagtcgcgtgataacgatctgctcgcaggcatttcctacgaacgccac
ctctggatggaaaaggagatcaaaagcgtggccaacattacgcgagccgatgtgtcggca
tttctcgatatcgcagcccggatggggctgaagcccgaggtgcggtgctatccgctcgaa
gaggccaatcgcgcgttgctcgacctgcgtcacggcagagccaaaggcgcggcggtgctc
attccgtaa

DBGET integrated database retrieval system