KEGG   Chlorobaculum parvum: Cpar_1362Help
Entry
Cpar_1362         CDS       T00725                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cpc  Chlorobaculum parvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpar_1362
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpar_1362
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpar_1362
Enzymes [BR:cpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cpar_1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1476796..1477599)
Genome map
AA seq 267 aa AA seqDB search
MKENRITRLMKQDKKLLLAYYMPEFPVPGATLPVLEALQENGADIIELGMPYSDPIGDGP
VIQDAAHKAISHGVTVRSILDLVKQARAGEGCKKITTPILLMGYSNPLIAYGGDCFMADA
VEAGVDGLLIPDLPPEESEDFLERARSFGLTVVYLISPVTPPDRIELIDCMSTDFSYCLA
VNATTGTGKLDTAGMDEQIAEYLKRVRKHAKKKFVVGFGIKDRERVRKMWELADGAVVGS
ALLQQVASAKTPEETAAMAAEFWQSLR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaatcgtattacccggctgatgaagcaggacaagaagcttctgctggcctac
tatatgcctgaatttcccgtgccgggcgcgaccctgccggtgctcgaagcgctgcaggaa
aacggggcggacatcatcgaactcggtatgccgtattccgatccgatcggtgacgggccg
gtgattcaggatgcggcgcacaaggcaatcagccacggcgtgaccgtgcggagcatcctc
gatctggtcaagcaggcgcgcgctggcgaagggtgtaagaagatcaccacgccgattctg
ctcatggggtacagcaatccgctcatcgcctacggtggcgattgtttcatggccgatgcg
gtcgaggctggtgtcgatggcctgctgattcccgacctgccgcccgaggagtcggaggat
ttcctcgaacgtgctcggagcttcggtctgacggtggtttacctcatttcaccggtaacg
ccacccgaccggatcgagctgatcgactgcatgtccacagatttttcgtactgtctggcg
gtcaatgccaccaccggtacgggcaagctcgacactgccggtatggacgagcagatcgcc
gagtacctgaaacgtgtgcgcaaacatgccaagaaaaagttcgtggtcggttttggcatc
aaggatcgcgagcgcgtgcgcaaaatgtgggagctggccgacggtgcggtggtcggttcg
gcgctgttgcagcaggtggcttcggcgaaaacgcccgaggagaccgctgccatggctgcc
gagttctggcaatcactgcgctga

DBGET integrated database retrieval system