KEGG   Chlorobaculum parvum: Cpar_1373Help
Entry
Cpar_1373         CDS       T00725                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpc  Chlorobaculum parvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpar_1373
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpar_1373
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpar_1373
Enzymes [BR:cpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cpar_1373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1491346..1492548
Genome map
AA seq 400 aa AA seqDB search
MTQKVTYNAPDEFGHFGTFGGKFIPETLVKNAADLEEEYLKAKDDPEFRQTFDNLLRHYV
GRPTPLYHAARLSERQGGAQIWLKREDLCHTGAHKINNALGQVLLAKRMGKKRIIAETGA
GQHGVATATVCALFGLDCIVYMGEEDIRRQAPNVARMKLLGTEVRPVTAGSRTLKDATSE
AIRDWMNNPEDTFYIVGSVIGMHPYPMMVRDFQSVIGRETRRQVVEQAGRLPDVIVACVG
GGSNAIGMFYEFLPDAKEVELIGVEAAGEGLEGRHAASLSKGEIGVLHGAMMKLLQDEHG
QVQEAHSISAGLDYPGVGPEHCYLQRLGLVSYTSTTDKEALAALDALAKTEGIICALESA
HAVHYAMKRAAEMPKESIIVVNLSGRGDKDMGTIMDELKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaaggtcacctacaacgcacccgacgaattcggccatttcggcacgttcggg
ggcaaattcattcccgaaacgctggtcaaaaacgccgccgatctcgaagaggagtacctc
aaggcgaaagatgatccggagttccgccagacattcgacaacctgcttcgccattacgtt
ggccgcccgaccccactctaccacgccgcgcggctcagcgaaaggcagggcggcgcccag
atctggctgaagcgcgaagacctctgccacaccggcgcgcacaaaatcaacaacgcactc
ggacaggtgctgctcgccaaacgcatgggcaaaaagcgcatcatcgctgaaaccggcgcg
ggccagcacggcgtggcgacggccaccgtctgcgcgctctttggtctcgactgcatcgtc
tatatgggtgaagaggacatccgccgccaggctccgaacgtcgcgcggatgaagttgctc
ggcacggaggttcgcccggtcactgcggggagcagaacgctcaaggacgccaccagcgaa
gcgatccgcgactggatgaacaatcccgaagataccttctacatcgtcggttcggttatc
ggaatgcacccgtatccgatgatggtgcgcgacttccagtcggtcatcggccgcgaaacc
cgtcggcaggttgttgaacaagcaggacgtctgcctgatgtaattgtggcctgcgttggc
ggcggtagcaatgccatcggcatgttctacgagttcctgccggatgccaaagaggtcgaa
ctgatcggcgtggaagccgccggagagggactcgaaggcaggcacgccgcttcgctctcc
aagggcgaaatcggcgtgttgcacggcgcaatgatgaagctcttgcaggacgagcacggc
caggtgcaggaggcgcactcgatctccgccggtctggactacccaggcgtcggcccggag
cattgctacctgcagaggcttgggctggtcagctacacctcaacaacggacaaagaagct
cttgcagcactcgacgcactggccaaaaccgaaggaatcatctgcgccctcgaatcggcc
cacgccgtgcactacgccatgaaacgagccgccgaaatgccgaaagagtcgatcatcgtg
gtgaatctctccggaaggggtgacaaggatatgggcaccatcatggatgagctgaagctg
taa

DBGET integrated database retrieval system