KEGG   Chlorobaculum parvum NCIB 8327: Cpar_1424Help
Entry
Cpar_1424         CDS       T00725                                 

Definition
asparagine synthase family amidotransferase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cpc  Chlorobaculum parvum NCIB 8327
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cpc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1556752..1558530
Genome map
AA seq 592 aa AA seqDB search
MCGIAGELRFDGVAASSEAVGRMIDILEPRGPDAEGLFAHNRVCFGHRRLKIIDLSDHAS
QPMVDSQLGLTLVFNGAIYNYPELRDELQQKGYTFFSHSDTEVIVKAYHAWGRDCVLHLQ
GMFAFAVWERDSGRVFFARDRLGIKPLYYHRNSSLMRFASSLPALVKSGGIDTSLGPVAL
NYYMSFHAVVPAPHTIFNGVKKLPPATTMTVEPDGQATIETYWQADYSRTDEELKRSEEE
WIDMVYESLLTSVKRRLVADVPVGVLLSGGLDSSLVVGLLSELGQKHLNTFSVGFEDVAE
EEGNEFRYSDIIAERYATHHHKIFVDHRELQTHLSDCIRAMSEPMVSHDVIGFYLLSREV
SKHVKVVQSGQGADEVFAGYHWYPPMMEATPASAVETYRNAFFDRDFDEYCQAVSSNYCK
EDYATAFVANHFAAPGAEEPIDQALRLDSNVMLVDDPVKRVDNMTMAWGLEARVPFLDHE
LVELAAKIPGKYKVPDGGKYVLKEVGRRIIPHEVIDRPKGYFPVPALKYLEGDYLDMARS
VLNRDVARQRGIFKKEYVDMLLDAPKEHITPLRGSKLWQITLLEYWLQEQGL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgccggagagctgcgtttcgatggcgtggcggcctcgtcggaggcggtt
ggtcgtatgatcgacattcttgaacccagagggcctgacgccgagggccttttcgctcac
aaccgggtctgtttcgggcaccggcggctgaaaatcatcgatctttccgaccacgcttcg
cagccgatggtcgatagccagctcggcttgacgctggtcttcaacggcgcgatttacaac
taccccgaattgcgcgacgagcttcagcaaaaagggtacaccttcttttcccactccgat
accgaggtgatcgtcaaggcctaccacgcatgggggcgcgattgcgttctgcacctgcag
ggcatgtttgcgttcgccgtgtgggagcgcgacagcgggcgggtcttttttgcgcgtgac
cggctcggcatcaagccgctttactaccacaggaacagctcgctgatgcggttcgcctcg
tcgctgcccgcgctggtgaaatccggcggcatcgacacctcgctcggtccggtcgccctg
aactattatatgagcttccacgcggtggtgcctgcgccgcacacgatcttcaacggcgtc
aaaaagcttccacctgcaaccacgatgacggttgagcccgatggacaggcgaccatcgaa
acttactggcaggccgattacagccgcaccgatgaggagctgaaacgttccgaagaggag
tggatcgacatggtgtacgagagcctgctgacgagcgtcaaacgccggttggtggctgac
gtgccggtcggcgtactgctctccggtggactggactcgtcgcttgtcgtcgggttgctg
agcgagctggggcaaaagcatctcaacacattctcggtcggcttcgaggatgtggccgag
gaggagggcaacgagttccgctactcggacatcatcgccgagcgctacgcgacgcaccac
cacaagatttttgtcgatcaccgcgagttgcagacccacctctccgactgcatccgggcg
atgagtgagccgatggtgagccacgacgtgatcggcttctacctgctctcgcgcgaggtg
agcaaacacgtcaaggtggtgcagagcgggcagggagcggacgaagtgttcgcgggctac
cactggtacccgcccatgatggaggcgactccggcctcggcggtcgagacctaccggaac
gcctttttcgaccgggacttcgacgagtattgccaggcggtttcgtcaaactactgcaag
gaggattacgccacggcgttcgtcgcgaaccactttgcagcgcccggtgcggaggagcct
atcgatcaggcgttgcggctcgacagcaacgtgatgctggtcgatgatccggtcaagcgg
gtggacaacatgacgatggcctggggactcgaagcgcgcgtgccgttcctcgatcacgag
ctggtcgagctggcggcgaaaatccctggcaagtacaaggtgccggacggcggcaagtat
gtgctgaaagaggtcgggcgccgcatcattccccacgaggtgatcgaccggccgaaggga
tacttccctgttccggcgctgaagtacctcgaaggcgactacctcgacatggccagaagc
gtgctcaatcgcgacgtggcccggcagcggggcatcttcaaaaaagagtatgtcgacatg
ctgctcgatgcgccgaaggaacacatcacaccgttgcgcggctcgaagctctggcagatc
acgcttctcgaatactggttacaggagcagggactatga

DBGET integrated database retrieval system