KEGG   Chlorobaculum parvum: Cpar_1493Help
Entry
Cpar_1493         CDS       T00725                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpc  Chlorobaculum parvum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpar_1493 (gpmA)
   01230 Biosynthesis of amino acids
    Cpar_1493 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpar_1493 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Cpar_1493 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpar_1493 (gpmA)
Enzymes [BR:cpc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cpar_1493 (gpmA)
Exosome [BR:cpc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cpar_1493 (gpmA)
  Exosomal proteins of melanoma cells
   Cpar_1493 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1635114..1635857)
Genome map
AA seq 247 aa AA seqDB search
MKKLVLLRHGESQWNRENRFTGWVDIDLSEKGREEAKAAGQLLKDEGFVFDMAYASVLKR
AIRTLWTVLDQMDLMWIPVTKSWRLNERHYGALQGLNKTETAQRHGDEQVLIWRRSYDTP
PPALDADDERHPSKDRRYAALTPEELPATECLKDTVARFLPYWHETIAPQIMDGKRVIIT
AHGNSLRALVKYLDNISDEDIVGLNIPTGIPLVYELDDDLKPIRSYYLGDQEELKKAQEA
VAKQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttgtcctgctgaggcacggcgaaagccagtggaacagggagaaccgtttt
accggctgggttgatattgatctttcggaaaaaggaagggaagaggccaaagccgccggt
cagctcctgaaggacgagggattcgtgttcgatatggcctacgcttcggtactcaaacgc
gccatcaggacgctctggacggtgctcgaccagatggatctgatgtggattcccgtcacc
aagtcctggaggttaaacgaacgtcactacggtgcgcttcaggggctcaacaagactgag
accgctcagcgccacggcgacgagcaggtgctgatctggcgccgcagctacgacactccg
cccccggccctcgatgctgacgacgaacgtcatccgagcaaggatcgccgttatgctgcg
ctcactcccgaggagcttccggctaccgagtgcctgaaagacactgtcgcgcgcttcctg
ccttactggcacgaaaccatcgcgccgcagatcatggacggcaagcgtgtcatcattacg
gcccacggcaactcgctccgtgcgctggtcaaatatctcgacaatatttccgatgaggat
atcgtcggcctgaacattccgactggcattccgctcgtgtacgagcttgacgacgatctg
aagccaatccggagttattacttgggcgaccaggaggagctgaagaaagcccaggaagcc
gtggcaaagcagggcaaggcctga

DBGET integrated database retrieval system