KEGG   Chlorobaculum parvum: Cpar_1493Help
Entry
Cpar_1493         CDS       T00725                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpc  Chlorobaculum parvum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpar_1493 (gpmA)
   01230 Biosynthesis of amino acids
    Cpar_1493 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpar_1493 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Cpar_1493 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpar_1493 (gpmA)
Enzymes [BR:cpc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cpar_1493 (gpmA)
Exosome [BR:cpc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cpar_1493 (gpmA)
  Exosomal proteins of melanoma cells
   Cpar_1493 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1635114..1635857)
Genome map
AA seq 247 aa AA seqDB search
MKKLVLLRHGESQWNRENRFTGWVDIDLSEKGREEAKAAGQLLKDEGFVFDMAYASVLKR
AIRTLWTVLDQMDLMWIPVTKSWRLNERHYGALQGLNKTETAQRHGDEQVLIWRRSYDTP
PPALDADDERHPSKDRRYAALTPEELPATECLKDTVARFLPYWHETIAPQIMDGKRVIIT
AHGNSLRALVKYLDNISDEDIVGLNIPTGIPLVYELDDDLKPIRSYYLGDQEELKKAQEA
VAKQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttgtcctgctgaggcacggcgaaagccagtggaacagggagaaccgtttt
accggctgggttgatattgatctttcggaaaaaggaagggaagaggccaaagccgccggt
cagctcctgaaggacgagggattcgtgttcgatatggcctacgcttcggtactcaaacgc
gccatcaggacgctctggacggtgctcgaccagatggatctgatgtggattcccgtcacc
aagtcctggaggttaaacgaacgtcactacggtgcgcttcaggggctcaacaagactgag
accgctcagcgccacggcgacgagcaggtgctgatctggcgccgcagctacgacactccg
cccccggccctcgatgctgacgacgaacgtcatccgagcaaggatcgccgttatgctgcg
ctcactcccgaggagcttccggctaccgagtgcctgaaagacactgtcgcgcgcttcctg
ccttactggcacgaaaccatcgcgccgcagatcatggacggcaagcgtgtcatcattacg
gcccacggcaactcgctccgtgcgctggtcaaatatctcgacaatatttccgatgaggat
atcgtcggcctgaacattccgactggcattccgctcgtgtacgagcttgacgacgatctg
aagccaatccggagttattacttgggcgaccaggaggagctgaagaaagcccaggaagcc
gtggcaaagcagggcaaggcctga

DBGET integrated database retrieval system