KEGG   Chlorobaculum parvum: Cpar_1493Help
Entry
Cpar_1493         CDS       T00725                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpc  Chlorobaculum parvum
Pathway
cpc00010  Glycolysis / Gluconeogenesis
cpc00260  Glycine, serine and threonine metabolism
cpc00680  Methane metabolism
cpc01100  Metabolic pathways
cpc01110  Biosynthesis of secondary metabolites
cpc01120  Microbial metabolism in diverse environments
cpc01130  Biosynthesis of antibiotics
cpc01200  Carbon metabolism
cpc01230  Biosynthesis of amino acids
Module
cpc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpar_1493
  Energy metabolism
   00680 Methane metabolism
    Cpar_1493
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpar_1493
Enzymes [BR:cpc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cpar_1493
Membrane trafficking [BR:cpc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Cpar_1493
Exosome [BR:cpc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cpar_1493
  Exosomal proteins of melanoma cells
   Cpar_1493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACF11891
JGI: Cpar1493
UniProt: B3QPN8
Position
complement(1635114..1635857)
Genome map
AA seq 247 aa AA seqDB search
MKKLVLLRHGESQWNRENRFTGWVDIDLSEKGREEAKAAGQLLKDEGFVFDMAYASVLKR
AIRTLWTVLDQMDLMWIPVTKSWRLNERHYGALQGLNKTETAQRHGDEQVLIWRRSYDTP
PPALDADDERHPSKDRRYAALTPEELPATECLKDTVARFLPYWHETIAPQIMDGKRVIIT
AHGNSLRALVKYLDNISDEDIVGLNIPTGIPLVYELDDDLKPIRSYYLGDQEELKKAQEA
VAKQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttgtcctgctgaggcacggcgaaagccagtggaacagggagaaccgtttt
accggctgggttgatattgatctttcggaaaaaggaagggaagaggccaaagccgccggt
cagctcctgaaggacgagggattcgtgttcgatatggcctacgcttcggtactcaaacgc
gccatcaggacgctctggacggtgctcgaccagatggatctgatgtggattcccgtcacc
aagtcctggaggttaaacgaacgtcactacggtgcgcttcaggggctcaacaagactgag
accgctcagcgccacggcgacgagcaggtgctgatctggcgccgcagctacgacactccg
cccccggccctcgatgctgacgacgaacgtcatccgagcaaggatcgccgttatgctgcg
ctcactcccgaggagcttccggctaccgagtgcctgaaagacactgtcgcgcgcttcctg
ccttactggcacgaaaccatcgcgccgcagatcatggacggcaagcgtgtcatcattacg
gcccacggcaactcgctccgtgcgctggtcaaatatctcgacaatatttccgatgaggat
atcgtcggcctgaacattccgactggcattccgctcgtgtacgagcttgacgacgatctg
aagccaatccggagttattacttgggcgaccaggaggagctgaagaaagcccaggaagcc
gtggcaaagcagggcaaggcctga

DBGET integrated database retrieval system