KEGG   Chlorobaculum parvum: Cpar_1497Help
Entry
Cpar_1497         CDS       T00725                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cpc  Chlorobaculum parvum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpar_1497
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpar_1497
   00640 Propanoate metabolism
    Cpar_1497
   00660 C5-Branched dibasic acid metabolism
    Cpar_1497
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cpar_1497
Enzymes [BR:cpc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cpar_1497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1639310..1640488
Genome map
AA seq 392 aa AA seqDB search
MNIHEYQGKGILKQFGVAVPKGIVAFSAEEAKQAAAELFEEQSSPVVVVKAQIHAGGRGK
AGGVKLAKSPEEVYEIAQKMLGTTLVTHQTGPEGKEVRRLLIEEGMNIDKEFYLGITLDR
ATSCNVLMVSTEGGMEIEKVAEETPEKLLKIQVNPKYGLQGFQAREAALFLGMQGEQFRN
GVKFIDALYKAYTTIDASLAEINPLVVTKEGRVLALDAKINFDDNAMYRHPDFHELRDIT
EEDPLEYEASKSNLNYVRLDGNVGCMVNGAGLAMGTMDLIQLAGGKPANFLDVGGGASPK
TVEEGFKIILGDKNVKAILVNVFGGIVRCDRVAGGVIEAAKNIGLTVPVIVRLEGTNAKE
AQKMLDESGLSLIAANGLRDAAEKVQKALASA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcagggcaaaggcatcctgaaacagttcggtgtggccgttccc
aagggcatagtagcattttcggctgaagaagcaaaacaggctgcggccgagcttttcgaa
gagcagtcaagccccgtagtggtcgtcaaagcgcagatccacgcaggtgggcgcggcaag
gccggcggcgtcaagctggccaaatcccccgaagaggtgtatgaaattgcccagaaaatg
ctcggcaccacactggtaacccaccagaccggccccgaaggcaaggaggtcaggagactg
ctgattgaagagggcatgaacatcgacaaagagttctacctcggcatcaccctcgatcgc
gctacgtcgtgcaacgtgctgatggtctcgaccgaaggtggcatggagatcgaaaaggtg
gccgaagagacccccgaaaagctcctcaaaattcaggtcaatccgaagtacggcctgcag
ggcttccaggctcgtgaagcggcgctcttcctcggcatgcagggtgagcagttccgcaat
ggcgtcaagttcatcgatgcgctgtacaaagcatacactaccatcgacgcctcgctggca
gaaatcaacccgctcgtggttaccaaagagggacgcgtgctggctctcgacgccaagatc
aacttcgatgacaatgccatgtaccgtcatccggatttccacgaactgcgtgacatcacc
gaagaagatccgcttgagtacgaagcatcgaagtcgaacctcaactacgtgcgcctcgac
ggcaacgtcggctgcatggtcaacggtgccggccttgccatgggcactatggacctcatc
cagcttgccggcggcaaaccggccaacttcctcgacgtaggcggtggcgccagccccaaa
acggttgaagagggcttcaagattatcctcggcgacaaaaacgtcaaggccatccttgtc
aatgtcttcggtggcatcgtgcgctgcgaccgcgttgccggaggcgtcatcgaagctgcc
aagaatattggcctgacagtaccggtcatcgtgcgcctcgaaggcaccaatgccaaagag
gcacagaaaatgctcgatgaatctggcctcagcctcatcgccgccaacggcctgagggat
gccgctgaaaaggtgcagaaagcactcgcctcggcctga

DBGET integrated database retrieval system