KEGG   Chlorobaculum parvum: Cpar_1530Help
Entry
Cpar_1530         CDS       T00725                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpc  Chlorobaculum parvum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpar_1530
   01230 Biosynthesis of amino acids
    Cpar_1530
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpar_1530
   00030 Pentose phosphate pathway
    Cpar_1530
   00051 Fructose and mannose metabolism
    Cpar_1530
   00052 Galactose metabolism
    Cpar_1530
  Energy metabolism
   00680 Methane metabolism
    Cpar_1530
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cpar_1530
Enzymes [BR:cpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cpar_1530
Protein phosphatases and associated proteins [BR:cpc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cpar_1530
Messenger RNA biogenesis [BR:cpc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cpar_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1674907..1676112
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVIKGAALMAMNKGLELYVIPNGYAGLYNLLNQDRLVKFDAAR
LDQFQASFAGSEAGHSRVKIKAISNPDKYNRIKNGMKKFDLDALIISGGDDSGSVMIDLN
QNGIQCIHCPKTMDLDLQTYSVGGDSTINRIAQFVEDLKTTGRTHNRVLVTEVFGRYAGH
TAFRSGVAAEADCILIPEIPVDWDVVYEHVVERFTRRIRQSDVHSGTYTIVVAEGMKNAD
GTDIVDESAGVDAFGHKKLAGAGKYVCQEIKKRFKSDPRMPLFMKETGMFVEGIYEIPEV
REVHPGHLVRAGHSSAYDINFGFEAGAAAVLLLLEGKTGVTISKVKGRKIEYIESSKAIE
QRYVDLDQVAMYEAIGTCFGRPPAEYDPIPREVDGVYERIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaatcggtatcctgaccagcggaggcgactgcggcggactgaacgccgtcatt
aagggcgccgcgctcatggccatgaacaaaggccttgaactctatgtgatccccaacggc
tacgccgggctgtacaacctgctgaatcaggaccgcctggtgaagttcgatgctgcgcgt
ctggaccagttccaggcaagtttcgccggttcggaagcaggccattcgagggtcaagatc
aaggcgatcagcaaccccgacaagtacaaccgcatcaagaacggtatgaagaagttcgat
ctcgacgccctcatcatcagcggcggcgacgactcgggcagcgtcatgatcgatctgaac
cagaacggcatccagtgcatccactgcccgaagacgatggacctcgacttgcagacctac
tcggtcggcggcgactccaccatcaaccgtatcgcccagttcgtcgaggatctcaaaacc
accggccgcacgcacaaccgcgtgctcgtcaccgaggtgttcggccgctatgccggtcac
acggcattccgcagcggcgtggctgccgaggcagactgcatcctgattccggaaattcca
gtggactgggatgtggtgtacgaacacgtcgtcgaacgcttcacccgccgcatccgccaa
agcgacgtgcacagcggcacctacaccatcgtggttgccgaaggcatgaagaacgccgat
ggcaccgacatcgtcgatgagtcggcgggcgtcgatgcgtttggccacaagaagcttgct
ggcgcgggcaagtacgtctgccaggagatcaaaaagcgcttcaagtccgacccccggatg
ccgctcttcatgaaggagaccggcatgttcgtcgaggggatttatgaaattccggaggtt
cgcgaagtgcatccgggccacctggtgcgcgccggacactcttcggcctacgacatcaac
ttcggcttcgaggctggcgcggcggcggtgctgctgctgctcgaaggcaaaaccggcgtc
accatctccaaggtcaaggggcgcaagatcgagtacatcgaatcatccaaggcaatcgaa
cagcgctacgtcgatctggaccaagtcgccatgtacgaagcgatcggcacctgcttcggt
aggccccctgccgagtacgacccgattccccgcgaagtggacggcgtctacgagcggatt
tactga

DBGET integrated database retrieval system