KEGG   Chlorobaculum parvum: Cpar_1541Help
Entry
Cpar_1541         CDS       T00725                                 

Definition
(GenBank) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpc  Chlorobaculum parvum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpar_1541
   01230 Biosynthesis of amino acids
    Cpar_1541
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpar_1541
   00051 Fructose and mannose metabolism
    Cpar_1541
   00562 Inositol phosphate metabolism
    Cpar_1541
Enzymes [BR:cpc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cpar_1541
Exosome [BR:cpc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cpar_1541
  Exosomal proteins of bladder cancer cells
   Cpar_1541
  Exosomal proteins of melanoma cells
   Cpar_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1687956..1688708)
Genome map
AA seq 250 aa AA seqDB search
MRRTIVVGNWKMNNTIAESIELATAIAEKVGATKPECEVGIAPTFPALHEVGKTIEWSGV
QLAAQNCHYENDGAFTGEVSTRMLAAAGCSYVILGHSERRQLFGETNEIVNRKVKKALAE
GLRVILCVGETLDEREAGVTDKIVTAQVVEGLADVSDISTLVIAYEPVWAIGTGKTATKE
QAQDVHASIRSTIEKLYGDSAARHLRIQYGGSVKPSNAAELFAMPDIDGGLIGGASLKVE
DFMAIIEAAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaaccatagttgttggcaactggaagatgaacaacaccattgccgagtcgatt
gagctggcgaccgccatcgccgaaaaggtcggcgctaccaagcccgaatgtgaggtcggc
attgcgcccacttttccagcgttgcacgaagtcggcaagacgatcgagtggagtggcgtc
cagcttgcagcccagaactgccattacgaaaatgacggggcgtttaccggcgaggtttcg
acccgcatgcttgccgccgcagggtgcagctacgtcattctcggccactcggagcgccgg
cagttgttcggcgaaaccaatgagatcgtcaaccgcaaagtgaagaaagcgctggccgaa
gggcttcgcgtcatcctgtgcgtcggcgagacgctcgacgagcgcgaggctggcgtgacc
gacaagatcgtcaccgctcaggttgtcgagggactggcggacgtgtcggacatcagcacg
ctggtgatcgcttacgagccggtctgggctattggcaccggaaagacggctaccaaagag
caggcgcaggacgttcatgcctccatccgcagcaccatcgaaaaactgtatggtgattct
gctgcccgccatctgcgcatccagtacggcggaagcgtcaagccgtcgaatgccgcagag
ctgttcgcgatgccggatatcgacggcggtttgattggcggtgcaagcctcaaggtcgaa
gacttcatggccattatcgaggctgcggggtaa

DBGET integrated database retrieval system