KEGG   Chlorobaculum parvum: Cpar_1553Help
Entry
Cpar_1553         CDS       T00725                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cpc  Chlorobaculum parvum
Pathway
cpc00330  Arginine and proline metabolism
cpc00332  Carbapenem biosynthesis
cpc01100  Metabolic pathways
cpc01130  Biosynthesis of antibiotics
cpc01230  Biosynthesis of amino acids
Module
cpc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cpar_1553
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Cpar_1553
Enzymes [BR:cpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cpar_1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACF11951
JGI: Cpar1553
UniProt: B3QPU8
Position
1698684..1699769
Genome map
AA seq 361 aa AA seqDB search
MSHHHPVYKRIVVKVGTNVITGRDGRLDPAILDSLTAQIAALAKDGVEVILVSSGAVGAG
RGIVSLTGGLTPVEKRQVLAATGQIRLINAYNDRFEKHGMLGAQLLVTKGDFRDRQHYLN
MRTCFEALLDQKIVPIVNENDAVAVTELMFTDNDELSGLIASMLQVDAHIILSNVDGLFD
MQSEDNPVIEEIDPGSKNFSQYIRPGKSEFGRGGMLTKCNIAHKLSRLGITVHIANGTAP
GILQTIVQGERVGTKFLAQKAKHSRKRWVAHSEGLEKGAVVINQGAIDALTSPERATSLL
PIGITGVEGSFQRGDVIRICSEKREVIGYGMASCSAEKAKSAMGQKGHKPVIHYDHLYLV
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaccaccacccggtttataaacgaatcgtcgtcaaggtcggcacgaacgtcatc
acaggccgcgacggcaggctcgacccggccatcctcgacagcctgacagcgcaaatcgca
gcgctggcaaaggacggcgtggaggtgattcttgtctcgtcgggcgctgtaggcgccggc
cggggcatcgtgtcgctcaccggcgggctcactccggtcgagaagcggcaggtgctcgcc
gccaccgggcagatccggctcatcaacgcctacaacgaccgcttcgaaaagcacggaatg
ctcggcgcgcaactcctcgtcaccaagggcgatttccgcgaccgccagcactacctcaac
atgcgcacctgcttcgaggcgctgctcgatcagaaaatcgtgcccattgtcaacgagaac
gatgcggtggcggtcactgagctgatgttcaccgataacgacgaactctccgggctgatc
gcctcgatgttgcaggtcgatgcgcacatcatcctctccaacgtagacggactgttcgac
atgcagagcgaagataatccggtgatcgaggagatcgaccccggttcgaagaacttcagc
cagtacatccgccccggcaaatcggagttcggacgcggcggcatgctcaccaagtgtaac
atcgctcacaagctctcgcggctcggcatcaccgtgcacatcgccaacggcaccgctccc
ggcattttgcagaccatcgtgcagggcgaacgcgtcggcacgaaattccttgcccagaaa
gccaagcacagccgcaaacgctgggtcgcccacagcgaagggttggaaaaaggagccgtc
gtcatcaatcagggcgccatcgacgccctcacctcccccgaacgtgccaccagccttcta
cccatcggcatcaccggagtcgaaggctcattccagcgcggcgacgtcatccgcatctgc
tcggagaagcgcgaagtcatcggctacggcatggcctcctgctccgccgaaaaagccaaa
tccgcgatggggcagaaaggccacaaaccggtaattcactacgaccacttgtatctggtg
ccgtag

DBGET integrated database retrieval system