KEGG   Chlorobaculum parvum NCIB 8327: Cpar_1772Help
Entry
Cpar_1772         CDS       T00725                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpc  Chlorobaculum parvum NCIB 8327
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1944961..1945575)
Genome map
AA seq 204 aa AA seqDB search
MFAFLRGELVTASREEAVVEVSGIGYRLHISSGTSSRLPVPGSPVFLYTHYHVREDLQQL
FGFLDEEELQLFRLLLSISGVGPKLAIAVLSGLSVGEIQEAIVSNRPETLFGISGVGRKT
AARIILELRDKILKIQPTSSAKAGAPSAVLSATQLIDDAVAALTTLGFPKASAQKAVSKV
LETTPGLSVEELVRTSLAAMHNNL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatttttaagaggtgagctggtgacggcctcccgtgaggaggcggttgtcgag
gtatccggcatcgggtatcgcctgcatatctcttcggggacgagcagccgcctgccggtt
ccgggcagcccggtgtttctctacacgcactaccatgtccgcgaggatcttcagcagctt
tttggttttctcgatgaggaggagcttcagcttttccggctgctgctctccatcagcggc
gtcgggccgaagctggcgatcgccgtgctgtcgggcctgagcgtgggggagattcaggag
gccatcgtctcgaatcgtccggaaaccttgttcggtatcagcggtgtggggcggaaaacc
gccgcgcgcatcattctcgaacttcgcgacaagattctcaaaatccagcccacgtcgtcc
gcaaaggcaggtgctccaagcgctgtgctttctgcgacacagttgatcgacgacgccgtg
gctgcgcttaccacactcggtttcccgaaagcttccgcgcagaaagcggtctccaaagtt
ctcgagacgactcccggactttcggtcgaggagctcgtcaggacgtcgcttgcggccatg
cacaacaatctctga

DBGET integrated database retrieval system