KEGG   Chlorobaculum parvum NCIB 8327: Cpar_1832Help
Entry
Cpar_1832         CDS       T00725                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cpc  Chlorobaculum parvum NCIB 8327
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2014854..2015513)
Genome map
AA seq 219 aa AA seqDB search
MQHTDDMVQERRGMVELLRRYGIRNSRVLDAFLTVKRHLFVDGESRMFAYHDSALPIGFG
QTISQPYTVAYMMELLVENCSSGKVLEIGTGSGFQAAILDALGYRVFTIECVAGLYELAS
ARFEKLGIPVQSRLGDGTLGWPEEAPFDAIIVTAAAPHEPRELMSQLADGGVLILPLGSL
ASQQMTVIRRKGNRFEHEGFDHFAFVPLLGREGWPDSDE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcaacataccgatgatatggtgcaggagcgcagggggatggtcgaattgctcaggcgt
tacggcatcaggaattcgagggtgctcgacgcgttcttgacggtcaaacgccatctgttc
gtcgatggcgaaagccggatgttcgcctatcacgactccgcgttgcccatcgggttcggg
cagaccatttcgcagccctacacggtggcctacatgatggagttgctggtcgagaactgt
tcgtctggcaaggtgcttgaaatcggaaccggatcgggattccaggcggcgattctcgat
gcgctcggttaccgggtctttacgatcgagtgcgttgcgggcttgtatgaactggcctca
gcgcgtttcgaaaagctgggtattccagtgcaaagccgcctcggcgacggtacgctcggc
tggccggaagaggccccgttcgacgccattatcgttacggcagccgcgccgcatgagccc
cgcgaactgatgagtcagcttgccgacggtggagtgctgattctgccgctcggcagtctc
gcctcgcagcagatgaccgtcattcgccgaaaaggcaaccggttcgagcatgagggattc
gaccacttcgcttttgtgccgcttttagggcgcgaagggtggccggattcggatgaatga

DBGET integrated database retrieval system