KEGG   Chlorobaculum parvum: Cpar_1846Help
Entry
Cpar_1846         CDS       T00725                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpc  Chlorobaculum parvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpar_1846
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpar_1846
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpar_1846
Enzymes [BR:cpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cpar_1846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2027643..2029019
Genome map
AA seq 458 aa AA seqDB search
MSTEPTKILLGEDELPRQWYNIQADLPSPMPPPVGLDGNPIGPDALAKVFPMNLIEQEVS
TERWIDIPEEILGILKLWRPSPLYRARRLEAALGTPAKIYYKNEGVSPAGSHKPNTAVAQ
AWYNREFGIKYLTTETGAGQWGSALAMSCKLIGIECKVFMVRISFDQKPFRKIMMKTWGA
ECIPSPSPQTAIGRKILEEMPDTPGSLGIAISEAIEQAVERDDTRYALGSVLNHVMLHQT
IIGLEAKKQFDKIGRYPDIVIGCAGGGSNFAGISFPFLYDKIHGRDVRVIGTEPEACPTL
TRAPYAYDSGDVAMMTPLLPMHSLGHTFIPPAIHAGGLRYHGMAPLVSHTKQLGLIEATA
LPQTECYEAALLFAHTEGFIPAPETSHAIAQTIREAKQAKEEGKEKVILMNWSGHGLMDL
QGYDAYLSGKISDYPLPEELLQRSLTASLAGLPKVPGV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagagcctaccaaaatcctcctcggcgaggatgaacttccccgtcagtggtac
aatattcaggctgacctgccttcacccatgccaccgccggtgggactggatggcaatccg
atcgggccggatgcgctggccaaggtttttccgatgaacctgatcgagcaggaggtgagc
accgagcgctggatcgatattccggaagagattctcggcatcctcaagctgtggcggccg
tcgccgctctaccgcgcgcggcggctcgaagcagcgctcggcactccggccaaaatctac
tacaagaacgaaggggtctcgcccgccgggagccacaagcccaacacggcggtggcgcag
gcgtggtacaaccgggagttcggcatcaagtacctcaccaccgaaaccggcgcggggcag
tggggcagcgcgctggcgatgagctgcaagctgatcggcatcgagtgcaaggtgttcatg
gtgcgcatcagcttcgaccagaagccgttccgcaaaatcatgatgaaaacctggggcgcg
gagtgcatcccgagcccgagtccgcagacggccatcgggcgcaagattctcgaagagatg
cccgacacccccggcagcctcggcatcgccatcagcgaagcgatcgagcaggccgtcgaa
cgcgacgacacccgctacgccctcggcagcgtgctgaaccacgtgatgctgcaccagacc
atcatcggcctcgaagccaagaagcagttcgacaagatcgggcgctacccggatatcgtc
atcggctgcgcgggcggcggctcgaacttcgcgggcatcagcttcccattcctctacgac
aagattcacggcagggatgtgcgggtaatcggcacggaaccggaggcgtgcccgacgctg
acccgcgccccctacgcctacgattcaggcgacgtggcgatgatgacgccgctcctgccg
atgcacagcctgggccacaccttcattcccccggccatccacgcaggcggcctgcgctac
cacggcatggcgccgctggtgagccacaccaagcagctcgggctgatcgaagccaccgcg
ctgccgcagaccgaatgctacgaagcggcgctgctcttcgcccacaccgaaggcttcatt
cccgcgccggagacctcgcacgccatcgcacagaccatccgcgaggcgaagcaggcaaaa
gaggagggcaaggagaaggtgattctgatgaactggtcgggccacgggctgatggacttg
cagggctacgacgcctacctctcaggcaaaatcagcgactacccgctgccagaggagctg
ctgcaacgctcgttgaccgcctcactggcgggacttccgaaagtgccgggagtttaa

DBGET integrated database retrieval system