KEGG   Chlorobaculum parvum: Cpar_1846Help
Entry
Cpar_1846         CDS       T00725                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpc  Chlorobaculum parvum
Pathway
cpc00260  Glycine, serine and threonine metabolism
cpc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpc01100  Metabolic pathways
cpc01110  Biosynthesis of secondary metabolites
cpc01130  Biosynthesis of antibiotics
cpc01230  Biosynthesis of amino acids
Module
cpc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpar_1846
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpar_1846
Enzymes [BR:cpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cpar_1846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACF12238
JGI: Cpar1846
UniProt: B3QQN5
Position
2027643..2029019
Genome map
AA seq 458 aa AA seqDB search
MSTEPTKILLGEDELPRQWYNIQADLPSPMPPPVGLDGNPIGPDALAKVFPMNLIEQEVS
TERWIDIPEEILGILKLWRPSPLYRARRLEAALGTPAKIYYKNEGVSPAGSHKPNTAVAQ
AWYNREFGIKYLTTETGAGQWGSALAMSCKLIGIECKVFMVRISFDQKPFRKIMMKTWGA
ECIPSPSPQTAIGRKILEEMPDTPGSLGIAISEAIEQAVERDDTRYALGSVLNHVMLHQT
IIGLEAKKQFDKIGRYPDIVIGCAGGGSNFAGISFPFLYDKIHGRDVRVIGTEPEACPTL
TRAPYAYDSGDVAMMTPLLPMHSLGHTFIPPAIHAGGLRYHGMAPLVSHTKQLGLIEATA
LPQTECYEAALLFAHTEGFIPAPETSHAIAQTIREAKQAKEEGKEKVILMNWSGHGLMDL
QGYDAYLSGKISDYPLPEELLQRSLTASLAGLPKVPGV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagagcctaccaaaatcctcctcggcgaggatgaacttccccgtcagtggtac
aatattcaggctgacctgccttcacccatgccaccgccggtgggactggatggcaatccg
atcgggccggatgcgctggccaaggtttttccgatgaacctgatcgagcaggaggtgagc
accgagcgctggatcgatattccggaagagattctcggcatcctcaagctgtggcggccg
tcgccgctctaccgcgcgcggcggctcgaagcagcgctcggcactccggccaaaatctac
tacaagaacgaaggggtctcgcccgccgggagccacaagcccaacacggcggtggcgcag
gcgtggtacaaccgggagttcggcatcaagtacctcaccaccgaaaccggcgcggggcag
tggggcagcgcgctggcgatgagctgcaagctgatcggcatcgagtgcaaggtgttcatg
gtgcgcatcagcttcgaccagaagccgttccgcaaaatcatgatgaaaacctggggcgcg
gagtgcatcccgagcccgagtccgcagacggccatcgggcgcaagattctcgaagagatg
cccgacacccccggcagcctcggcatcgccatcagcgaagcgatcgagcaggccgtcgaa
cgcgacgacacccgctacgccctcggcagcgtgctgaaccacgtgatgctgcaccagacc
atcatcggcctcgaagccaagaagcagttcgacaagatcgggcgctacccggatatcgtc
atcggctgcgcgggcggcggctcgaacttcgcgggcatcagcttcccattcctctacgac
aagattcacggcagggatgtgcgggtaatcggcacggaaccggaggcgtgcccgacgctg
acccgcgccccctacgcctacgattcaggcgacgtggcgatgatgacgccgctcctgccg
atgcacagcctgggccacaccttcattcccccggccatccacgcaggcggcctgcgctac
cacggcatggcgccgctggtgagccacaccaagcagctcgggctgatcgaagccaccgcg
ctgccgcagaccgaatgctacgaagcggcgctgctcttcgcccacaccgaaggcttcatt
cccgcgccggagacctcgcacgccatcgcacagaccatccgcgaggcgaagcaggcaaaa
gaggagggcaaggagaaggtgattctgatgaactggtcgggccacgggctgatggacttg
cagggctacgacgcctacctctcaggcaaaatcagcgactacccgctgccagaggagctg
ctgcaacgctcgttgaccgcctcactggcgggacttccgaaagtgccgggagtttaa

DBGET integrated database retrieval system