KEGG   Chlorobaculum parvum: Cpar_1858Help
Entry
Cpar_1858         CDS       T00725                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cpc  Chlorobaculum parvum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cpar_1858
Enzymes [BR:cpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cpar_1858
Exosome [BR:cpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cpar_1858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2041451..2042902)
Genome map
AA seq 483 aa AA seqDB search
MAILSIDQGTTGTTCMIYDRSGNVLARAYRELTQCYPQAGWVEHDPKEIWQTVVECVVEV
RGAYSGHIEAIGITNQRETTVVWDRRNGEPVHRAIVWQCRRTAELCNRYRGEEAAIRAKT
GLPVDAYFSATKIRWILDAHPEADPSNLLFGTIDTWLIWKLTGGEVHATDLTNASRTLLF
DIHERRWDAELCELFGVPLSMLPEVRPSMGGFGAVRAIPELDGVPIAGVAGDQQAALFGQ
CCFESGSVKNTYGTGCFMVMNTGDKCVSSSHGLLTTLALDGAGRSCYAVEGSVFIGGAVM
QWLRDGLQLIGSAAESEAIARSVESNGGVYVVPAFVGLGAPHWNMEVRGTITGLTRGSSR
VHIVRAALESIAYQSHDVFRAMVADTGIQPQSLTVDGGAVSNEFLMQFQADLLGVPVHRP
RNIESTALGAACLAGLEAGVWNSADELRALNGVERVFTPAMPEAERETLLAGWQKALRQT
LVS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggccattctttccatcgaccagggcacgaccggcaccacctgcatgatctacgaccgt
tcgggcaacgtgctcgcccgcgcgtatcgagagctgacgcaatgctacccgcaggcaggg
tgggtcgagcacgatccgaaggaaatttggcaaacggtggtcgagtgcgtggtcgaggtg
cggggcgcatattcaggtcacatcgaagccatcggcatcaccaaccagcgcgagaccacc
gtggtgtgggatcggcggaacggagagccggtgcaccgtgccatcgtctggcagtgccgc
cggacggcggagctttgcaatcgttatcgaggcgaggaggcggcgattcgcgcgaagacc
gggctgccggtggacgcctacttcagcgccaccaagattcgctggattctcgatgcgcac
ccggaggccgatccgtccaacttgctcttcggcactatcgacacgtggctcatctggaag
ctgaccggcggagaggttcacgcaactgatctgacgaatgcatcccgcacgctgctgttc
gacatccacgagcggcggtgggatgcggagctgtgcgagctgttcggcgtgccgctgtcg
atgctgccggaggtgcgtccgtcgatgggcgggttcggcgcggtgcgggcgattccggag
cttgacggcgtgccgattgcgggcgtggcgggcgaccagcaggcggcgctcttcgggcag
tgctgctttgagtcggggtcggtcaagaacacctacggcaccggctgtttcatggtgatg
aacaccggagacaagtgcgtgagttcgagccacggcctgttgacgacgctcgcgctcgac
ggcgctggccggagctgctacgcagtggaggggtcggtgttcatcggcggcgcggtgatg
cagtggttgcgcgatggcttgcaactcatcggcagtgccgccgagtccgaggcgattgcg
cggtcggtcgaatcgaacggcggggtttacgtcgtgcccgcgttcgtcggccttggcgca
ccgcactggaacatggaggtgcggggcacgattaccggcctgacgcgcggctcgtcgcgg
gtgcacatcgttcgcgcggcgctggagtcgatcgcctaccagtcgcacgacgttttccgc
gcgatggtggccgacaccggaatccagccgcagtcgttgaccgtcgatggcggtgcggtg
agcaacgagttcctgatgcagttccaggccgacctgctcggcgtgccggtgcaccgcccg
cgcaacatcgaatcgaccgcgctcggtgcggcctgcctcgcgggcctcgaagccggagtg
tggaactccgccgacgaactgcgagcgctcaatggcgtcgaacgggtcttcacccccgca
atgccggaggcggaacgggaaacattgctggcgggctggcaaaaggcgctgaggcagacg
ttggtatcgtaa

DBGET integrated database retrieval system