KEGG   Chlorobaculum parvum: Cpar_1911Help
Entry
Cpar_1911         CDS       T00725                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cpc  Chlorobaculum parvum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpar_1911
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpar_1911
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cpar_1911
Enzymes [BR:cpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cpar_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2111156..2112472
Genome map
AA seq 438 aa AA seqDB search
MIFYSTTKASAPVTMKKATLEGLAPDGGLYVPSEMPRFSAEEISLLESGSFTNIAFAIAK
KFVGDEIPLDRLSALIDDCFTFETPLHELDADTFVEELFHGPTLAFKDYGARFLARMTGF
YAAEESRMITVLVATSGDTGSAVAYGFHGIPNTRVVLLYPSGKVSHLQEQQLTTAGDNVH
ALEVKGDFDDCQRLVKQAFVDQSLRQKLTLTSANSINISRLIPQSFYYAWAALQLRQHQS
NALPTFSVPSGNYGNLTAGVMAKMMGFPIGGFIAASNANDSVTRYLDEGRFEPRPTIKTL
TTAMDVGNPSNFARLLHFYEGDFRKMGVDIAGIAVSDAETVETIRAVHDRYGYIMDPHTA
VGYRALEHFRDTRSGAGKPAVVLSTAHPVKFDEAIRTATGKEVPIPESMHDIMNKPKQAT
LIGNRYEDLAGFLGNLDR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgattttctacagcaccacgaaagcttccgctcccgtcacgatgaaaaaagctaccctc
gaaggcctcgcgcccgatggggggttgtacgtgccatccgaaatgccgcgcttctccgcc
gaggagatttcgctgctggagagcggctcgttcaccaatatcgcctttgccatcgccaag
aagttcgtaggtgatgaaattccgctcgaccgcctctcggcgctgatcgacgactgcttc
accttcgaaacgcctctgcacgaactcgatgccgatacctttgtcgaagaactgttccac
ggcccgacgctcgcgttcaaggattatggcgcacgcttcctggcaaggatgaccggcttt
tacgccgccgaagagagccggatgatcaccgtgctggtggccacctccggcgacaccggc
agcgcggtagcttacggcttccacggcattcccaacacccgggtggtgctgctctacccg
tcgggcaaggtgagccatttgcaggagcagcagctcaccacggcgggcgacaacgtccat
gctctcgaagtcaagggcgatttcgatgactgccagcgcctggtcaagcaggccttcgtc
gatcagtcgcttcggcagaagctgacgctgacctcggccaactccatcaacatctcgcgc
ctcattccgcagtcgttctactacgcctgggctgccctgcaactccgccagcaccaatcg
aatgcgctgccgaccttctcggtgccgagcggcaactacggcaacctgaccgccggcgtg
atggcgaaaatgatgggcttcccgatcggcggattcatcgcggcctcgaacgccaacgac
agcgtcacacgctatctcgacgagggacgcttcgaaccgcggccgaccatcaagaccctg
accacggcgatggacgtcggcaacccgagcaacttcgcccgcctgctgcacttctacgaa
ggcgacttccgcaaaatgggtgttgacattgcaggcatcgcagtctcggacgctgaaacc
gttgaaacgatccgtgctgtacatgatcgatacggctacatcatggatccccataccgcc
gtcggatatcgggcgctcgaacacttccgcgatacccgctcaggtgccgggaaaccggcg
gtcgtgctctccacggcgcatccggtcaagttcgacgaagcgatcaggacggccaccggc
aaggaggtgccgatcccggaatcgatgcacgacatcatgaacaagccgaaacaggctacg
ctgatcggtaacagatacgaagatcttgccggattccttggcaatctcgaccggtaa

DBGET integrated database retrieval system