KEGG   Chlorobaculum parvum NCIB 8327: Cpar_1998Help
Entry
Cpar_1998         CDS       T00725                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpc  Chlorobaculum parvum NCIB 8327
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cpc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cpc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2198457..2199578
Genome map
AA seq 373 aa AA seqDB search
MKKSLLAALLLLLSFTTALAAPSTPDSLSIKIGQMLMVGFRGLDASSDPAFEKALRAGQI
GGVVLFDYDVPSKSPVRNIESPKQVRRLTEELQSLAPMPLFIAVDQEGGRVCRLKPSRGF
PPTVSAAYLGRLDNADSTRQAAGTTAKLLKSLGINMNLAPVVDLNVNPENPVIGKLDRSF
SSNPAVVARQARIFVDTFHQQGIIAALKHFPGHGSSTTDTHKDFTDVTTTWSKTELEPYR
TLIGNGYSDPVMTAHVFNAKLDSSYPATLSKATIDGLLRKQLGFRGVVISDDMQMKAIAD
RYGLEQAIRLAIDAGVDVLLFGNNVGIYDPEIAEKANAIIRRLVEKGDVTPERIDASYRR
IIALKQRTITPAP
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagcctcctcgcggcgctgctgcttttgctgagcttcaccaccgcgctggcc
gcgccatcgacgcccgacagcctgtcaatcaagatcggccagatgctcatggtcggcttc
agggggctcgacgccagcagcgatccggcattcgagaaggcgcttcgagctggccagatc
ggcggcgtggtgctcttcgattacgacgtcccctccaaatctcccgtgcgcaacatcgag
tcgccgaagcaggttcgtcggcttaccgaagagctgcaaagcctcgcgccaatgccgctc
ttcatcgctgtcgatcaggagggcggacgcgtctgtcgcctcaaaccgtcgcgcggcttt
ccgccaaccgtctccgccgcttaccttggcaggctggacaacgccgacagcacccggcag
gccgctggaaccacggcgaagctgctcaagagcctcggtatcaacatgaacctcgcaccg
gtggtcgatctgaacgtcaatccggaaaacccggttatcggcaagctcgaccggagcttc
tccagcaatccggcggtggtcgcccggcaggcaagaatcttcgtcgatacgttccaccag
caaggaatcatcgctgccttgaagcactttcctggccacggcagttcgacaaccgacacc
cacaaagacttcaccgacgttaccaccacctggtcaaaaaccgaactcgaaccctaccgg
acgctaatcggcaacggctacagcgacccggtcatgaccgcccacgtcttcaacgcaaag
ctcgacagcagctacccggcgacgctctcgaaagccacgattgacggcctcctgcgcaag
cagctcggcttccggggcgtggtcatcagcgatgacatgcagatgaaagccatcgccgac
cgctacggcctcgaacaggcgatccggctggcgattgacgcaggcgtcgatgtgctgctc
ttcggcaacaacgtaggcatctatgatcctgaaatcgccgaaaaagccaacgccatcatc
cgccgtctcgttgaaaaaggcgacgtcacgcccgaacggatcgacgcctcgtaccggcgg
atcatagccctgaaacaacgaaccatcaccccagcaccatga

DBGET integrated database retrieval system