KEGG   Chlorobaculum parvum NCIB 8327: Cpar_2030Help
Entry
Cpar_2030         CDS       T00725                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cpc  Chlorobaculum parvum NCIB 8327
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2231842..2232609)
Genome map
AA seq 255 aa AA seqDB search
MNECEDRRLSGVLIIHGFTANLESVRSLFEPLERLGLSLSAPLLRGHGGASPDDLRGVTW
QDWVADTEAELKKLAGHGGKVVVIGHSMGALLALQLAERQPELVDSIVLATPPIRLVSLL
APGRPLHFFAPLVSRVVDRWGFFPTFADPANALMPEQYDWAPTRTILSMFELIQETERVM
NRVLKPALILHARHETVVRPESAEIIYRAIATPPEQKSIIWFEKTDHQIFCDCERQRAIE
SVVSFVADRQVVDDR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagtgtgaggacaggcgattatcgggtgtattgatcattcacggctttacggca
aacctcgaaagcgtcaggtcgctgttcgagccgctcgaaagactcggcctcagcctttcc
gcgccgttgcttcgggggcacggtggcgcgtcgcctgatgatttgcgcggcgtgacctgg
caggattgggttgccgataccgaggcggagctcaaaaaacttgccggacacggaggcaaa
gttgtggtgatcggccacagcatgggggcgctgcttgccttgcagcttgccgaacgccaa
cctgagctggttgattcgatcgtgcttgccaccccgccaatcaggcttgtctctttgctc
gccccgggtcgcccgctgcatttttttgctcccttggtcagccgtgtggttgatcgctgg
ggcttcttcccgacctttgccgatcctgccaacgccctgatgccagagcaatacgactgg
gcgccgacgcgaacgattctgtcgatgttcgagctgattcaagagaccgagcgtgtcatg
aaccgtgtcctgaagccggcgctgattcttcatgccaggcatgaaaccgtcgttcgaccc
gagagcgccgagatcatctatcgggccatcgctacgccgccggagcagaagtcgattatc
tggttcgaaaaaaccgatcatcagattttctgtgattgcgagcgccaacgggccatcgag
tcggtggtcagcttcgtggcggaccgtcaggtcgttgacgatcggtag

DBGET integrated database retrieval system