KEGG   Clostridium perfringens 13: CPE0044Help
Entry
CPE0044           CDS       T00074                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cpe  Clostridium perfringens 13
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CPE0044 (folA)
   00670 One carbon pool by folate
    CPE0044 (folA)
Enzymes [BR:cpe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CPE0044 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(57339..57824)
Genome map
AA seq 161 aa AA seqDB search
MFSIIVAKSINNIIGVNNKMPWNIPSDLKRFKELTMGKKILMGRKTFESLPFVLPGRTHL
VLTTKKDFSYNHKDIIIYNDLNKLIEEYKDSKEEIFVIGGGKIYSELLKYTSKLYITEVL
KEYKGDTYFPKVDYSKWIKTYESSIYEENDNKFKFFNYKKI
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgttttctataattgttgccaaaagtattaataatatcattggagttaataacaaaatg
ccttggaatattccatctgatctaaaaagatttaaagaacttactatgggaaaaaaaata
ttaatgggaagaaaaacctttgaatctcttccttttgttttacctggaagaactcattta
gttttaactacaaagaaagatttttcttataatcataaggacataattatttataatgat
ttaaataagcttattgaagaatataaagatagtaaggaagaaatatttgtaataggtggt
ggaaaaatatattctgagcttttaaaatatacttcaaaattatatataactgaagtttta
aaggaatataaaggagatacttatttccctaaagtagattattctaaatggataaaaact
tatgaaagttctatttatgaagagaatgataataagtttaagttttttaactataaaaag
atataa

DBGET integrated database retrieval system