KEGG   Clostridium perfringens 13: CPE0047Help
Entry
CPE0047           CDS       T00074                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cpe  Clostridium perfringens 13
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
60206..60802
Genome map
AA seq 198 aa AA seqDB search
MEFYPVAIEKLIEEFAKLPSIGKKSAQRLTLHILNLPKDEVEEFANALVKARGTIKYCSV
CGNFTDTDPCAICSNPNREKDIICVVEQPKDIMTMEKVKEFNGLYHVLHGTISPMQGRGP
QDIRIRELVARMSGDVKEVIVATNPTIEGEATAMYISKILKPLDVKVTRIAAGIPVGGDL
EYADEVTLSKALEGRTVI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaattttatccagtagctatagaaaagttaattgaagagtttgctaaattacctagt
ataggaaaaaaatcagctcaaaggttaactttacatattttaaatttgccaaaggatgag
gtagaggaatttgcaaatgccttagtaaaagcaagaggaactattaaatattgttctgta
tgtggtaactttacagatacagatccatgtgcaatatgttcaaatcctaatagagaaaaa
gatataatatgtgtggttgaacaacctaaggatattatgacaatggagaaggttaaagaa
tttaatggtttatatcatgttttacatggaactatttctccaatgcaaggaagaggacca
caggatataagaataagagaattagtagcaagaatgagcggagatgtaaaagaggttatt
gtagctacaaaccctactattgaaggggaagctacagctatgtatatttcaaagatatta
aaaccattagatgttaaggttactagaattgcagcaggaatcccagttgggggagattta
gagtatgcagatgaagtaactttatctaaagccttagaaggtagaactgttatataa

DBGET integrated database retrieval system