KEGG   Clostridium perfringens 13: CPE0154Help
Entry
CPE0154           CDS       T00074                                 

Definition
beta-hexosamidase A
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpe  Clostridium perfringens 13
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CPE0154
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CPE0154
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CPE0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
195005..196774
Genome map
AA seq 589 aa AA seqDB search
MVNLKVKPYNLDEESIKWVEDTIKNMSIEEKIGQLFVNMGASRDEEYLKSVLNNYHIGAV
RYNPGKAEEVYEQNRILQENSKIPLLIAANTEAGGNGACTDGTYVGNEVKIAATQDPHYA
YELGRISGIEASAIGCNWSFAPIVDINRNWRNPIISTRTWSADADQTLELSLEYMRGIME
SGILPAAKHFPGDGIDERDQHLSFAPNTLSVEEWNATFGKVYSGLIEAGLPSIMAGHIAL
PEYVKYFNPDATIKEMNMPATLSKYILTDLLKGQMGFNGLVVTDASHMVAMTSAMKRKDM
LPTAIAAGSDLFLFFNDPDEDFQWMMEGYKNGVITEERLHDALTRILGLKASLGLHKKAK
TEILQPKEEAMAKIGLEENKKAALEIADKAITLVKNNEEIFPISPDKTKRVLLVKVKGFD
GGFGKFLALMQGAQKGPVDIMKELLEQEGFQVEIYESPVDKIMKLPKEEMGAAIGNIYAG
KRPIAELTSKYDLIINLADVGASVDQRLQWPPSKGTPDIPFYVNEIPTIFISLQCPFHLA
DVPQVKTYINAYDSKEFNIKALVDKMMGRSEFKGVSSVDAFCGLKDTRY
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatttaaaagtaaaaccatataatctagatgaagaatccataaaatgggtagaa
gatacaataaaaaatatgtctatagaagaaaaaataggacaactatttgtaaacatggga
gcaagccgtgatgaagaatatttaaaaagtgttttaaataattatcatattggagctgtt
cgttataatccaggtaaggctgaagaagtatatgaacaaaatagaatactacaagaaaat
tctaaaattccactattaatagcagctaatacagaggctggtggaaatggtgcttgtaca
gatggaacatatgttggtaatgaggttaaaattgctgctactcaagatccacactatgct
tatgaattaggaagaatatcaggaattgaagcatctgctataggatgtaactggagtttt
gctccaattgttgatataaacagaaactggagaaatccaataatatctactagaacttgg
tctgcagatgccgatcaaactttagagttatctttagaatatatgagaggcataatggaa
tctggaattttaccagctgctaagcatttcccaggtgatggtatagatgaaagagatcag
catttatcatttgctccaaatactttatcagttgaagagtggaatgctactttcggaaaa
gtatactctggattaattgaagcaggtcttccatcaataatggctggacatattgcttta
cctgaatatgtaaaatattttaatccagatgctacaattaaagaaatgaatatgcctgca
actttaagtaaatatatattaacagatttattaaaaggtcaaatgggattcaatggattg
gttgtaactgatgcatctcacatggttgctatgacttcagctatgaagcgtaaagatatg
ttaccaactgcaattgcagcaggtagtgacttattcttattctttaatgatccagatgaa
gattttcaatggatgatggaaggatataagaatggagttataactgaagaaagacttcat
gatgcattaactagaatattaggcttaaaggcatctttagggcttcataagaaagctaag
actgaaatattacaaccaaaagaagaagctatggctaagattggtttagaagaaaacaaa
aaggctgctttagaaatagcagataaggcaataactttagttaagaataatgaagaaata
ttcccaatttcaccagataagactaaaagagtattacttgtaaaggttaaaggtttcgat
gggggatttggtaaattcttagctcttatgcaaggagcacaaaaggggcctgtagatata
atgaaagaattattagaacaggaaggattccaagtagaaatatatgaatcaccagtagat
aagatcatgaagttaccaaaagaagagatgggtgctgctattggaaatatttatgctggc
aagcgtccaatagctgaattaacttcaaaatatgatttaattataaatttagctgatgta
ggggcaagtgttgatcaacgtcttcaatggccaccaagtaaaggtacaccagatattcca
ttctatgttaatgaaatacctactatctttatatctctacaatgcccattccatttagct
gatgttccacaagttaaaacttatataaatgcttatgattctaaagaatttaatattaaa
gctttagttgataaaatgatgggacgttcagaatttaaaggagtaagttcagtagatgct
ttctgcggacttaaagatactagatattaa

DBGET integrated database retrieval system