KEGG   Clostridium perfringens 13: CPE0167Help
Entry
CPE0167           CDS       T00074                                 

Gene name
pbg
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cpe  Clostridium perfringens 13
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CPE0167 (pbg)
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CPE0167 (pbg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
213872..215941
Genome map
AA seq 689 aa AA seqDB search
MKNYGPISSKVTKMLHGADYNPEQWIDMPNIWGEDVRLMKLSHTNVVAVGIFSWTMLEPE
EGKFNFEWLDEIMDLMHKNGNYVILATPSGAKPIWMAHKYPETLRVAPNRVRNLYGERHN
HCYTSPIYREKIAIIDRLLAERYKDHPALILWHISNEFEGQCYCPLCEQAFRDFLREKYD
NDINKLNKAWWTKFWSHTYASFDEIEAPAPHGEPALHGLNLDWMRFVTHQTLDYYKHERS
ILKEITPDIPVTTNFHDYISLFRGIDYWKFAPYLDVVSWDNYPYWHGERTDDHEGSRIGF
VHDLNRAILNGKPFMMMESSPSSTNWQPVAKLRRPGMHVLSSLQAVAHGSDTVQYFQWRK
SRGSSEKFHGAVVDHCGHENTRVFRDVTKVGEILSKLDDVIGTSVEPQVAVIYDWENYWA
INDAQGPRIEQKDYFETCQKHYKAFWDMSIPTDVINMDCDFSKYKVVVAPMLYMVRPGVG
ERLEEFVKNGGTLVTTYWSGIVDENDLCFLGGFPGPLKKVTGIWAEELDALYDEDVNYVS
IEEGNSLGMKGEYEARIFCDLIHSEGAEVLATYKTDFYKGMPALTCNNFGEGQAYYIAFR
NNDEFLSDFYSSLAKKLTLKRAIEIDLPKGINAQVRMDEKNEFVFFMNFSSEEKTIDIKD
LDLTDMVTGEKVTKEMEIEPYGVRIVRRK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaattatggaccaataagttctaaagtaacaaaaatgcttcatggagcagattac
aacccagagcaatggattgatatgcctaacatatggggagaagatgttagattaatgaag
ctttctcatacaaatgttgtagctgtaggcatattctcatggacaatgttagagccagag
gaaggtaagtttaactttgaatggttagatgaaatcatggatttaatgcacaagaatgga
aactatgtaatacttgctacaccaagtggagctaagccaatatggatggctcataagtat
ccagaaactttaagagttgctccaaacagagtaagaaacttatatggagagcgtcataac
cactgctatacatctcctatatatagagaaaaaattgctataatagatagattattagct
gaaagatataaagaccatcctgctttaatcttatggcatatttcaaatgaatttgaaggt
caatgttactgtcctttatgtgaacaagcttttagagatttcttaagagagaaatatgat
aatgacataaataaattaaataaagcttggtggactaagttctggagccatacatacgct
tcttttgatgaaatagaggcaccagctcctcatggagaaccagctcttcatggattaaac
ttagattggatgagatttgttactcaccaaactttagattactacaagcatgaaagaagc
atattaaaggaaatcacaccagatattcctgtaactactaacttccatgactatatttca
ttattcagaggaatagattactggaaatttgctccttacttagatgttgtatcatgggat
aactatccttactggcatggtgaaagaacagatgaccacgaaggaagtagaattggattt
gttcatgacttaaatagagcaattttaaatggtaagccatttatgatgatggaaagttca
ccaagttcaacaaactggcaaccagttgcaaaacttagacgtccaggaatgcatgtttta
tcttctcttcaagctgtagctcatggttcagatacagttcaatatttccaatggagaaaa
agtagaggatcatcagaaaagttccatggagctgttgttgatcactgtggacatgaaaat
acaagagtatttagagatgtaactaaggttggagaaattctatcaaaacttgatgacgta
ataggaacttctgtagagccacaagtagctgttatttacgattgggaaaattactgggca
ataaatgatgctcaaggtcctagaatagagcaaaaggattactttgaaacttgtcaaaag
cactacaaagctttctgggatatgtcaattccaacagatgttataaacatggattgcgat
ttctcaaaatataaggtggttgtagcaccaatgctttatatggtaagaccaggtgttgga
gaaagattagaggaattcgttaaaaatggaggaactttagtaacaacttactggagtggt
attgttgatgagaatgacctttgcttcttaggaggattccctggcccattaaagaaagtt
acaggaatctgggcagaggaattagatgcactttatgatgaagatgtaaactatgtttct
attgaagagggaaatagtttaggaatgaaaggtgaatatgaagctagaatattctgtgac
ttaattcactcagaaggagctgaagttcttgcgacatacaaaacagacttctacaaagga
atgccagctttaacttgtaacaactttggagagggacaagcttactatatagcatttaga
aataatgatgagttcttatcagatttctactcaagcttagctaagaagttaactttaaag
agagctatagaaattgacttaccaaagggaattaatgctcaagttcgtatggatgaaaag
aatgagtttgtattctttatgaacttctcatcagaggaaaaaacaatagatattaaagat
cttgatttaacagatatggtaactggtgaaaaggtaactaaggaaatggaaatagaacct
tatggagttagaatagttagaagaaaataa

DBGET integrated database retrieval system