KEGG   Clostridium perfringens 13: CPE0266Help
Entry
CPE0266           CDS       T00074                                 

Definition
(RefSeq) beta-hexosamidase A
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpe  Clostridium perfringens 13
Pathway
Amino sugar and nucleotide sugar metabolism
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CPE0266
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CPE0266
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CPE0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
336095..338632
Genome map
AA seq 845 aa AA seqDB search
MLLKKLAAILTVASIGATIFTSNKEVMATDSYSKAKEIVSNMTLEEKLGQMIMPDFRMWQ
EEGAKEPSDLTEINSEVAEVIDKYDLGGVILFAENVKEISQTTTLIHDLQEIAINDEDGN
LPLLITLDQEGGIVTRLGEGTNLPGNMALGATRSEKSSYDAGYVIGKELNALGVNVDFAP
VLDTNNNPENPVIGVRSISSNPELVGKLGKNIANGIQDQGVAATAKHFPGHGDTSTDSHY
GLPMVDKSIEELRETELKPFKIAIENGIDMIMTAHIQFPQIEKDTFISKKDGSQISIPAT
LSDDIIKGILREEMEYDGVVITDAMNMKAISDHFGELESTKMAINAGIDIILMPTILRNN
EDVKKLDYVVNGILDSIKSGEIKEEEITDSAERIVKLKIDRGIIDLKNNTASLEEKIKKA
KKTVGSVENRNIERRISEEAITITKNEDNILPLNPKEGEKVLLIAPNESQIHSMKFGINR
LIHENSLNNIKLNTYEYNNIGIIDDVLKEKIESSDYIIVASLSSNANHLKPGAWNRDLPR
SVIDYGNKLNKDTVLISLRNPYDLAAYDNAKAQVVAYGFKGMDPTEGDTLFPTKSSGPNI
PASMGVVFGAVEPKGKLPVDIPSLNNDGTMNTEVNYYDYGHGITNINSLGNVNISMNKKI
NLGDNFQVKFNLSDFNEIVAGKYRAKIKFQGEKLEFINGKVEFSGDLQTNIIDNNTLEVL
INLEEGSLKANEVNFILEFKAIDKAELTSIEITSSELIDEKGRCFKQKYVISEFSIEDNK
EDKPLSPDEDKEDEENNEDLENSDDNNKDELPQTGSGVGKEFIFGLGSLSLLVGIGLKSK
RFKRK
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaaagaaattagctgcaatattaactgtagcctcaataggtgctactattttt
actagtaataaagaggttatggcaactgactcttatagtaaggcaaaagaaatagtttct
aacatgactttagaagaaaagcttggtcaaatgataatgcctgattttagaatgtggcag
gaagaaggagctaaagaaccaagtgatttaacagaaataaatagtgaagttgcagaggtc
atagataaatatgatttaggtggagttatactttttgctgaaaatgttaaggagatatct
cagacaactactttaatacatgatttacaagagatagctataaatgatgaagatggaaat
ttaccattacttataactttagatcaggagggtggaatagtaactaggcttggagaagga
actaacttacctggtaatatggcattaggtgccactagaagtgaaaagtcttcatatgat
gctggttacgtaataggaaaagaattaaatgctttaggagtaaatgtagactttgctcca
gttctagatacaaataataatccggaaaatcctgttataggagtaagatcaatttctagt
aatccagaacttgtagggaagttaggaaaaaatattgctaatggtattcaggatcaaggg
gttgcggctactgcaaaacattttccaggtcatggtgatacttcaacagattcacattat
ggtttgccaatggtagataaatctattgaagaacttagggaaacagagcttaaaccattt
aaaatagctatagaaaatggtatagatatgataatgacagctcatatacaatttcctcaa
atagagaaagatacttttatatcaaaaaaagatggaagccaaatatcaattccagccaca
ttatcagatgatattataaaaggaattttaagagaagaaatggagtatgatggtgttgta
ataactgatgcaatgaatatgaaagctatatcagatcattttggagaattagagtcaaca
aaaatggctataaatgcagggatagatattattcttatgcctactatattaagaaataat
gaggatgttaaaaaattagattatgtagtaaatgggattttagactctattaaaagtgga
gaaataaaagaagaggaaataactgattcggctgaaagaatcgttaaactaaaaatagat
agagggataattgatttaaaaaataatactgcatctttagaggaaaagattaagaaagct
aagaaaactgttggatctgtagaaaatagaaatatagaaagaaggatttcagaggaagca
atcactattactaaaaatgaggataatatacttccactgaatcctaaagaaggagaaaaa
gttttattaatagcgccaaatgaaagtcaaattcatagtatgaagtttggtataaataga
cttatacatgaaaatagtttaaataatattaagttaaacacctatgagtacaataacata
ggaataatcgatgatgtattaaaagaaaaaatagaaagttctgattatataatagtggct
tctctgtcaagtaatgctaaccacttaaagcctggggcttggaatagagatttacctagg
tcagtaattgattatggaaataagttgaataaagatactgtattaataagtttaagaaat
ccatatgatttggcagcttatgataacgctaaggcacaggtagttgcatatggatttaaa
ggaatggatccaacagaaggagatactttgtttccaactaaatcttcaggacctaatata
ccagcatctatgggagttgtttttggagctgtagagcctaagggaaagttaccagtagat
attccaagtttaaataatgatggaactatgaatactgaagttaattattacgattatgga
catggcattacaaatatcaatagcttgggaaatgttaatattagtatgaataaaaaaata
aatttaggtgataattttcaagtaaagtttaatttaagtgattttaatgaaatcgtagca
ggtaaatatagagccaagattaaatttcaaggagaaaaattagaatttattaatggtaag
gtagagtttagtggagatttacaaactaatattatagataataatactttagaagtttta
ataaatttagaagagggttctcttaaggctaatgaagtgaatttcattttagaatttaag
gcaattgataaagctgaattaactagcatagaaataacaagttcagaacttattgatgaa
aaaggaagatgttttaaacagaaatatgttatttcagaattttcgatagaagataataaa
gaggataagcctctaagcccagatgaggataaagaagatgaagaaaataatgaggattta
gagaatagtgatgataataataaagatgaattaccacaaacaggttcaggtgttggtaaa
gaattcatttttggattagggtctctatcacttttagttggaattggattaaaaagcaaa
agatttaaaagaaaatag

DBGET integrated database retrieval system