KEGG   Clostridium perfringens 13: CPE0318Help
Entry
CPE0318           CDS       T00074                                 

Gene name
fucI
Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
cpe  Clostridium perfringens 13
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cpe00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
402971..404758
Genome map
AA seq 595 aa AA seqDB search
MKTYPKIGIRPTIDGRQGGVRESLEEKAMKMAQAAKKLIENSLYYADGTPVQCVLASRTI
GGSGDAGIVQQEFTGKNIVATLSVTPSWCYGTETMDLDPNTIKAIWGFNGTERPGAVYLA
AAMSGYAQKGIPAFKIYGHDVQELDDDTIPVDVQEKILSFARGAIAVGQMKGKSYVNIGA
SSMGIAGSQVDISFFEDYLGMLVEFVDMTEILRRIHLEIFDPIEYDKALNWIKENCREGI
DINEGKDLPDIVKKSKVIPADKDWEFIAKQAIIIRDILYRNEKLGDLGWEEEARGRNAIA
GGFQGQRQWTDWLPNGDFTEAIMASTFDWNGPRQVTAFATENDTLNGVSMLLGTLLTNKA
PIFSDVRTYWSPESVKRVTGKELTGKAKNGIIHLINSGASALDGTAAAKDKDGNKTMKEF
WNMTNEDVQSCLKATDWCRANYEYFRGGGFSSHFKTEAELPVTLIRVNLIKGIGPTLQIA
EGYTCVIDEDIHQILDERTDKTWPTTWFAPNLGECGFETVYDVMNHWGANHGAFVHGHIG
SDLITLASMLRIPVTLHNVPRERIFRPNIFEGAGTKALETADFEICRLLGPLYKK
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacgtatccaaaaataggtattcgtccaacaatagatgggcgtcaaggtggagtt
cgtgaatcattagaagaaaaagctatgaaaatggctcaggcagcaaaaaaattaatagag
aattctctttattatgctgatggaactccagttcaatgtgtattagcaagcagaacaatt
ggaggtagtggagatgctggaattgttcaacaagagtttacaggaaaaaatatagtagcc
acattatccgtaactcctagttggtgttatggaacagaaacaatggatcttgacccaaat
acaattaaagctatatggggatttaatggaacagaaagaccaggtgcagtttatttagca
gctgcaatgagtggatatgctcaaaaaggaattcctgcttttaaaatttatggccatgat
gttcaggagctagatgatgatacaattcctgtagatgttcaagaaaaaatactttcattt
gcaagaggggctattgctgttggtcagatgaaaggtaagtcttatgtgaatattggggct
tcatctatgggaattgcaggttcacaagtagatataagtttttttgaagactatttagga
atgctagttgagtttgttgatatgacagagattttgcgccgtattcatttagaaattttt
gatccaatagaatatgataaagctttaaattggattaaggagaattgtcgtgaaggtata
gatataaatgaaggaaaagatttacctgacattgtgaaaaaatcaaaagttattccagcg
gataaggattgggagtttattgcaaaacaagctattattattcgagatattttatatagg
aatgaaaagttaggagatttaggttgggaagaagaggcaagaggtagaaatgctatagca
ggaggatttcaaggacaaagacagtggactgattggttacctaatggtgattttactgaa
gcgattatggcttctacctttgattggaatggacctagacaggtaacagcttttgctact
gaaaatgatacattaaatggtgtttccatgttattaggaacattacttactaataaagca
cctattttctctgatgttagaacttattggagtccagagtccgttaagagggtaacagga
aaagaattaactggaaaagctaaaaatggaattatacatcttattaattcaggtgcatct
gctttagatggaactgcagctgcaaaagataaagatggaaataaaacaatgaaagagttt
tggaatatgacaaatgaagatgttcagtcatgtttaaaagcaacagattggtgtagagct
aattatgaatatttccgtggcggtggattctcatcacattttaaaacagaggcagaatta
ccagttacattaataagagtaaatttaattaaaggtattggacctaccctacaaattgct
gaaggatatacttgtgtaattgatgaagatatacatcaaattttagatgaaagaacagat
aagacttggcctactacttggtttgctcctaatttaggggaatgtggttttgaaactgtt
tatgatgtaatgaatcattggggagcaaatcatggagcatttgtccatggtcatatagga
tctgatttaattactctagcaagtatgttaagaattccagttacacttcataatgtacca
cgtgaaagaatttttagaccaaatatttttgaaggagcaggaacaaaagctttggaaact
gctgattttgaaatatgtagattattagggccactttataaaaaatag

DBGET integrated database retrieval system