KEGG   Clostridium perfringens 13: CPE0319Help
Entry
CPE0319           CDS       T00074                                 

Definition
(GenBank) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00051  Fructose and mannose metabolism
cpe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CPE0319
Enzymes [BR:cpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CPE0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: BAB80025
UniProt: Q8XNL4
Position
404788..405444
Genome map
AA seq 218 aa AA seqDB search
MLMEKERKKLIEYGKKLVVEKLTKGTGGNLSVFDRNLGYIAITPSGIDFFEMKDRDIVIL
DLNGNVVEGENLPSSEWQMHLKLYKTREDIDAVIHAHTLYSTVLACLHEELPATHYMIAV
AGKNVRVANYATYGTEELAENAAKAMEERKAVLLANHGILAGSNDLLNAFNIIEEVEYCS
KIYCISKSIGEPFILPDDEMELMEKKFTSYGQRKSKEA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgttaatggaaaaagaaagaaagaaattaatagaatatgggaaaaaattagttgttgaa
aagctaacaaaaggaacaggtggaaacctaagtgtttttgatagaaatttaggttatatt
gctattactccttctggaattgatttttttgaaatgaaggatagagatattgtgatttta
gatttaaatgggaatgtagtagaaggggagaatcttccttctagtgaatggcaaatgcat
ttaaaattatataaaactagggaggatattgatgctgtaattcatgcacatacactttat
tctacagttttagcatgtttacatgaagaattgccagcaacacattatatgattgcagta
gccggtaaaaatgtaagagttgcaaattatgctacttatggaacagaagaattagcagaa
aatgcagcaaaagctatggaagaaagaaaagctgtattattagctaaccatggaatttta
gctggatcaaatgatttgttgaatgcttttaatattatagaagaagttgaatattgttca
aagatatactgtatttctaaaagtattggagagccatttatattgccagatgatgagatg
gaattaatggagaaaaaatttacttcttatggccagcgtaaatctaaggaggcatag

DBGET integrated database retrieval system